DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna2b

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_697298.4 Gene:chrna2b ZFINID:ZDB-GENE-041001-99 Length:550 Species:Danio rerio

Alignment Length:449 Identity:83/450 (18%)
Similarity:157/450 (35%) Gaps:144/450 (32%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMH 262
            ||||.....|:                  .|.|   ::..:.|......|. .::.:.::.|.:.
Zfish    43 FDGYNKWSRPV------------------PNTS---DVVIVKFGLSIAQLIDVDEKNQMMTTNVW 86

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLY 327
            :...|.|.:|.|||.|:.::.|...|...||.|.:.:.|.| .....|....:..::..|.:...
Zfish    87 LKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNA-DGEFAVTHMTKAHLFHTGKVRWV 150

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH-VNTPSGWSF 391
            ...:..:|..:| ...:|.::..|.::.|          :..||..:..:...|: |:....|..
Zfish   151 PPAIYKSSCSID-VTFFPFDQQNCKMKFG----------SWTYDKAKIDLERIENTVDLKDYWES 204

  Fly   392 TQMSVVLVENDSQRRYNPK--GMMQKMTGDVAIEFTLQRNRSFY---------------MTVFYL 439
            .:.:::    ::...||.|  ....::..|:...|.::|...||               :.||||
Zfish   205 GEWAII----NAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYL 265

  Fly   440 P-------------LIACQMFLIL-SFVLRSTRRSSLIL---------------IALLIAAWGLM 475
            |             |::..:||:| :.::.||   ||::               ::::|..:.|.
Zfish   266 PSDCGEKITLCISVLLSLTVFLLLITEIIPST---SLVIPLIGEYLLFTMIFVTLSIVITVFVLN 327

  Fly   476 YMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYP---------PRSK---------- 521
            ...|..|.|.:|               |:: |  .::|||.|         |.|:          
Zfish   328 VHHRSPSTHKMP---------------CWV-H--SVFLDLIPRWLFMRRPAPDSRRRQKLLLLQR 374

  Fly   522 -APGWLVRVINSNVLRCILGLRFSDSTD--------YCDIQENPWHHMAKILNNLSSIL 571
             .||...|..|:::.......|..:|.:        |.|::          |..|||.:
Zfish   375 QVPGMTARPANASLSTSTSWFRGQNSGEDESCRHFSYKDLE----------LGTLSSAI 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 37/221 (17%)
chrna2bXP_697298.4 LIC 6..543 CDD:273305 83/450 (18%)
Neur_chan_LBD 35..241 CDD:280998 42/235 (18%)
Neur_chan_memb 248..541 CDD:280999 39/208 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.