DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna9

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021326868.1 Gene:chrna9 ZFINID:ZDB-GENE-090312-63 Length:580 Species:Danio rerio

Alignment Length:346 Identity:73/347 (21%)
Similarity:127/347 (37%) Gaps:61/347 (18%)


  Fly   183 FSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRS 247
            ||:.|....:...|. .:||.:.:.|:  |:|.          :|.|.::...||.|.       
Zfish    18 FSAQGRFAQKLLNDL-MEGYSNALRPV--EDTD----------KALNVTLQITLSQIK------- 62

  Fly   248 LAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ 312
             ..::.:.:|.|.:.:...|.|:.|.|..|::..||....|...:|:|.:.:.|.|.:.......
Zfish    63 -DMDERNQVLTTYLWVRQIWHDAYLSWDKEEYDGLEVIRIPSNLVWRPDIVLYNNADEEDSSGPP 126

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELG---LNGQE-----GQENVALI 369
            ...:::..||.||..:..:..:|..|| ...:|.:...|::..|   .||.:     |.|:..| 
Zfish   127 DTNVVLRYNGEITWDSPAITKSSCKVD-VSYFPFDSQECNLTFGSWTYNGNQVDIAMGMESGDL- 189

  Fly   370 YDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYM 434
                      ::.|:... |....|..|       :.....|.......|:.....|:|..|||:
Zfish   190 ----------SDFVDNVE-WECHGMPAV-------KNVIMYGCCSDPYPDITYTVLLKRRSSFYI 236

  Fly   435 TVFYLPLIACQMFLILSFVL--RSTRRSSL-ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI 496
            ....||.........|.|.|  .|..:.|| :.:.|.:..:.|| :.....|....|::..|.:.
Zfish   237 FNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLM-VAESMPPSESVPLIGKYYIA 300

  Fly   497 MMT--------TTYCYILHIC 509
            .||        |.:...:|.|
Zfish   301 TMTMITASTSLTIFIMNIHFC 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 3/8 (38%)
Neur_chan_LBD 212..429 CDD:280998 44/225 (20%)
chrna9XP_021326868.1 Neur_chan_LBD 25..231 CDD:308532 48/247 (19%)
Neur_chan_memb 239..>367 CDD:308533 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.