DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_696993.2 Gene:chrnb4 ZFINID:ZDB-GENE-120809-1 Length:525 Species:Danio rerio

Alignment Length:350 Identity:72/350 (21%)
Similarity:138/350 (39%) Gaps:70/350 (20%)


  Fly   202 YGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMH 266
            |...|.|.:   .:||::...|.:..      |.|.|::           :...::.|.:.:..:
Zfish    50 YNKLIRPAL---NRTERVTVLLQVSL------AQLISVN-----------EREQIMTTNVWLTQN 94

  Fly   267 WRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNL 331
            |.|.||.|.|.::..::....|...||.|.:.:.|.|       ..:||:.|:.| :|.|:..::
Zfish    95 WNDYRLSWDPAEYEGIDKLRIPSRHIWLPDIVLYNNA-------DGTYEVTVFTN-AIVLFNGSI 151

  Fly   332 QLASW---------CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPS 387
               :|         |....:::|.::..|.::......:..|...|:..|     |.:....|||
Zfish   152 ---AWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDLLLKSD-----AASMDDFTPS 208

  Fly   388 G-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILS 451
            | |....:       ..:|..:|   :.....|:..:|.::|...||.....:|.:......||.
Zfish   209 GEWDILAL-------PGRRTVSP---LDATYVDLTYDFIIKRKPLFYTINLIIPCVLITSLAILV 263

  Fly   452 FVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVP-PMMTAYKVI-MMTTTYCYILHICIIW 512
            |.|.|.  .:.:|.:..||.....|:.:::...|..:. |::..|.:. |:..|:..|..:|:  
Zfish   264 FYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIITSVCV-- 326

  Fly   513 LDLY---PPRSKAPGW-----LVRV 529
            |:::   |.....|.|     |||:
Zfish   327 LNVHHRSPSTHSMPAWVKIVFLVRL 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/227 (19%)
chrnb4XP_696993.2 LIC 14..501 CDD:273305 72/350 (21%)
Neur_chan_LBD 37..242 CDD:280998 46/238 (19%)
Neur_chan_memb 249..500 CDD:280999 24/105 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.