DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_001921314.1 Gene:chrna3 ZFINID:ZDB-GENE-070822-1 Length:508 Species:Danio rerio

Alignment Length:383 Identity:77/384 (20%)
Similarity:143/384 (37%) Gaps:63/384 (16%)


  Fly   183 FSSFG-----------SNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANL 236
            ||||.           |......:...|..|...|.|:                  ||.|.|.  
Zfish    10 FSSFSPLCFLLSGVCCSEAEHRLFSVIFSSYNQYIRPV------------------ENVSDPV-- 54

  Fly   237 SSISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL 300
             .:.|......|. .::.:.:::|.:.:...|.|.:|.|.|:|||.:|....|..:||||.:.:.
Zfish    55 -VVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNKIWKPDIVLY 118

  Fly   301 NGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQEN 365
            |.|:... ||....:.::..||.:|.....: ..|.|......:|.:...|.::.|         
Zfish   119 NNAVGDF-QVDDKTKALLRFNGDVTWIPPAI-FKSSCKIDVTYFPFDYQNCTMKFG--------- 172

  Fly   366 VALIYDDQR-KPIAPNEHVNTPSGWSFTQMSVVLVENDS-----QRRYNPKGMMQKMTGDVAIEF 424
             :..||..: ..:.....:|....|...:.:::    |:     ..:||   ..:::..|:....
Zfish   173 -SWTYDKAKIDLVLIGSTINLKDFWESGEWTII----DAPGYKHDIKYN---CCEEIYTDITYSL 229

  Fly   425 TLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTR-YASPHYV 486
            .::|...||.....:|.:......:|.|.|.|.  .:.:|.:..||.....|:.:|. ..|...|
Zfish   230 YIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV 294

  Fly   487 PPMMTAYKVI-MMTTTYCYILHICIIWLDLYPPRSKA-PGWLVRVINSNVLRCILGLR 542
            .|::..|.:. |:..|...::.:.::.:....|::.. |.|:.||..|.:.|.:...|
Zfish   295 IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLSLLPRVMFMTR 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/19 (26%)
Neur_chan_LBD 212..429 CDD:280998 42/224 (19%)
chrna3XP_001921314.1 LIC 4..499 CDD:273305 77/384 (20%)
Neur_chan_LBD 29..235 CDD:280998 46/246 (19%)
Neur_chan_memb 242..498 CDD:280999 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.