DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_005169811.1 Gene:chrnb2 ZFINID:ZDB-GENE-070821-3 Length:543 Species:Danio rerio

Alignment Length:386 Identity:88/387 (23%)
Similarity:153/387 (40%) Gaps:78/387 (20%)


  Fly   191 ARWFYDCGF----DGYGSEIAPIVKEETKTEKLL--SHLNIQAENASMPANLSSISFHFQTRSL- 248
            |.|...|..    .|||::     .||...|.||  :|.|.....|:..:.:.::........| 
Zfish     3 ALWTLFCILAIVKSGYGAD-----TEERLVEHLLNPAHYNKLIRPATNGSEVVTVQLMVSLAQLI 62

  Fly   249 AYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS 313
            :..:...::.|.:.:...|:|.||.|.||:|..::....|...||.|.:.:.|.| ..|      
Zfish    63 SVHEREQIMTTNVWLTQEWQDYRLTWSPEEFDGMKKVRLPSKHIWLPDVVLYNNA-DGM------ 120

  Fly   314 YELMVYAN------GSI-----TLY--AQNLQLASW------CVDSARNWPSERVTCDIELGLNG 359
            ||:..|:|      ||:     .:|  |..:::..:      |..|.|:|..:|...|:.|    
Zfish   121 YEVSFYSNAVVSYDGSVFWLPPAIYKSACKIEVKHFPFDQQNCTLSFRSWTYDRTEVDLVL---- 181

  Fly   360 QEGQENVALIYDDQRKPIAPNEHVNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIE 423
               :.:||.:.|            .|||| |....:.....||.|...|          .|:..:
Zfish   182 ---RADVASMDD------------FTPSGEWDIIALPGRRNENPSDPTY----------VDITYD 221

  Fly   424 FTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYV 486
            |.::|...||.....:|.:......||.|.|.|.  .:.:|.:..||.....|:.:::...|..:
Zfish   222 FIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSL 286

  Fly   487 P-PMMTAYKVI-MMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRCILGLR 542
            . |::..|.:. |:..|:..:..:|:  |:::   |.....|.| |:::..|.|..:|.:|
Zfish   287 DVPLVGKYLMFTMVLVTFSIVTSVCV--LNVHHRSPTTHTMPPW-VKLVFLNKLPALLFMR 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 88/387 (23%)
Neur_chan_LBD 212..429 CDD:280998 55/240 (23%)
chrnb2XP_005169811.1 LIC 4..526 CDD:273305 87/386 (23%)
Neur_chan_LBD 23..228 CDD:280998 55/241 (23%)
Neur_chan_memb 235..525 CDD:280999 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.