DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and chrna4b

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001041528.1 Gene:chrna4b / 556619 ZFINID:ZDB-GENE-090505-3 Length:627 Species:Danio rerio


Alignment Length:324 Identity:70/324 - (21%)
Similarity:132/324 - (40%) Gaps:31/324 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EKLLSHLNIQAENASMP-ANLSSISF-HFQ---TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKP 276
            |:||..|.|.....|.| ||:|.:.. ||.   .:.:..::.:.::.|.:.:...|.|.:|.|.|
Zfish    32 ERLLQSLFINYNKLSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNP 96

  Fly   277 EDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSA 341
            |::.::.|...|...||:|.:.:.|.|..... |....:..|:.||.|......:..:|..:| .
Zfish    97 EEYENVTSIRIPSEIIWRPDIVLYNNADGDFA-VTHLTKAQVFYNGRIKWKPPAIYKSSCSID-V 159

  Fly   342 RNWPSERVTCDIELGLNGQEGQENVALIYDDQR-KPIAPNEHVNTPSGWSFTQMSVVLVENDSQR 405
            ..:|.::..|.::.|          :..||..: ..|:....|:....|...:..::    ::..
Zfish   160 TFFPFDQQNCKMKFG----------SWTYDRAKIDLISMASDVDQMDYWESGEWVII----NAVG 210

  Fly   406 RYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLP--LIACQMFLILSFVLRSTRRSSLILIA 466
            .||.|  ....::..|:...|.::|...||.....:|  ||:|...|:.........:.:|.:..
Zfish   211 TYNIKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISV 275

  Fly   467 LLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKA---PGWL 526
            ||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::...|:.   |.|:
Zfish   276 LLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSII-ITVFVLNVHHRSSRTHSMPHWV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/219 (21%)
chrna4bNP_001041528.1 Neur_chan_LBD 31..237 CDD:280998 47/220 (21%)
Neur_chan_memb 244..618 CDD:280999 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.