DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna10a

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021337092.1 Gene:chrna10a ZFINID:ZDB-GENE-060503-725 Length:532 Species:Danio rerio

Alignment Length:354 Identity:69/355 (19%)
Similarity:124/355 (35%) Gaps:73/355 (21%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |:.|.|.:.|:    ..||.:|        |.::...||.|        :..::.:.:|...:.:
Zfish    38 FNNYTSALRPV----EDTEDIL--------NVTLQITLSQI--------IDMDERNQILTAYLWI 82

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            ...|.|..|.|..|::..|::...|...:|:|.:.:.|.|.......:.: .:::..:|.|...|
Zfish    83 RQVWIDKYLTWNKENYDGLDTIRIPGSYVWRPDIVLYNSADDHFTSTMDT-NVVIRHDGQIMWDA 146

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELG-----------LNGQEGQENVALIYDDQRKPIAPNEH 382
            ..:..:|..|| ...:|.:...|.:..|           ||..|..:...|:           ::
Zfish   147 PAITKSSCKVD-VSFFPFDAQQCRLTYGSWTYNGNQLDILNAMESADLADLV-----------DN 199

  Fly   383 VNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMF 447
            |.    |....|       .::|.....|.......||.....|:|..|||:....:|.:.....
Zfish   200 VE----WEVLGM-------PAKRNIILYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFL 253

  Fly   448 LILSFVL--RSTRRSSL-ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMT--------TT 501
            ..|.|.|  .|..:.|| :.:.|.:..:.|: :.....|....|::..|.:..||        |.
Zfish   254 APLGFYLPADSGEKVSLGVTVMLALTVFQLL-VAEIMPPSENVPLIGKYYIATMTMITASTALTI 317

  Fly   502 YCYILHICIIWLDLYPPRSKAPGWLVRVI 530
            :...:|.|      .|.....|.|..:.|
Zfish   318 FVMNIHHC------GPDAKPVPDWAKKFI 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/228 (18%)
chrna10aXP_021337092.1 Neur_chan_LBD 31..422 CDD:332142 69/355 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.