DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRNA9

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_060051.2 Gene:CHRNA9 HGNCID:14079 Length:479 Species:Homo sapiens

Alignment Length:395 Identity:83/396 (21%)
Similarity:146/396 (37%) Gaps:79/396 (20%)


  Fly   187 GSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYE 251
            |....:.|.|. |:.|.:.:.|:    ..|:|:|        |.::...||.|.        ..:
Human    28 GKYAQKLFNDL-FEDYSNALRPV----EDTDKVL--------NVTLQITLSQIK--------DMD 71

  Fly   252 QTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYEL 316
            :.:.:|...:.:...|.|:.|.|..:.:..|:|...|...:|:|.:.:.|.|.....:.:.:..:
Human    72 ERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVV 136

  Fly   317 MVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELG---LNGQEGQENVALIYDDQRKPIA 378
            :.| :|.||..|..:..:| ||.....:|.:...|::..|   .||.:.....||...|....|.
Human   137 LRY-DGLITWDAPAITKSS-CVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIE 199

  Fly   379 PNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIA 443
            ..|       |....|..|       :.....|...:...||.....|:|..|||:....:|.:.
Human   200 DVE-------WEVHGMPAV-------KNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVL 250

  Fly   444 CQMFLILSFVL--RSTRRSSL-ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYI 505
            ......|||.|  .|..:.|| :.|.|.:..:.||          |..:|.|.:.:.:...| ||
Human   251 ISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLM----------VAEIMPASENVPLIGKY-YI 304

  Fly   506 LHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAK--ILNNLS 568
            ..:.:|        :.:....:.|:|.:               :|..:..|..|.|:  ||..:|
Human   305 ATMALI--------TASTALTIMVMNIH---------------FCGAEARPVPHWARVVILKYMS 346

  Fly   569 SILVI 573
            .:|.:
Human   347 RVLFV 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 1/4 (25%)
Neur_chan_LBD 212..429 CDD:280998 45/220 (20%)
CHRNA9NP_060051.2 LIC 10..474 CDD:273305 83/396 (21%)
Neur_chan_LBD 31..236 CDD:280998 50/242 (21%)
Neur_chan_memb 244..474 CDD:280999 29/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.