DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001036149.1 Gene:chrna6 ZFINID:ZDB-GENE-090312-91 Length:512 Species:Danio rerio

Alignment Length:387 Identity:75/388 (19%)
Similarity:146/388 (38%) Gaps:56/388 (14%)


  Fly   176 LVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSIS 240
            |:|..::...|.|......:...|..|...|.|:                  ||.|.|.   ::.
Zfish    12 LLITLITQDCFSSKGEDRLFRRLFRRYNQFIRPV------------------ENVSDPV---TVE 55

  Fly   241 FHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGAL 304
            |......|. .::.:.:::|.:.:...|.|.:|.|.|.:|..:|....|..:||:|.:.:.|.| 
Zfish    56 FEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYNNA- 119

  Fly   305 QSMGQVL--QSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVA 367
              :|..|  ...:.::..:|:|| :.......|.|......:|.:...|.::.|          :
Zfish   120 --VGDFLVEDKTKALLKFDGTIT-WVPPAIFKSSCPMDITYFPFDYQNCSMKFG----------S 171

  Fly   368 LIYDDQR-KPIAPNEHVNTPSGWSFTQMSVVLVENDS-----QRRYNPKGMMQKMTGDVAIEFTL 426
            ..||..: ..:.....||....|...:..::    |:     ..:||   ..:::..|:...|.:
Zfish   172 WTYDKAKIDLVLIGSKVNLKDFWESGEWEII----DAPGYKHDIKYN---CCEEIYPDITYSFYI 229

  Fly   427 QRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTR-YASPHYVPP 488
            :|...||.....:|.:......:|.|.|.|.  .:.:|.:..||.....|:.:|. ..|...|.|
Zfish   230 RRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIP 294

  Fly   489 MMTAYKVI-MMTTTYCYILHICIIWLDLYPPRSKA-PGWLVRVINSNVLRCILGLRFSDSTD 548
            ::..|.:. |:..|...::.:.::.:....|.:.. |.|:..|....:.|.:|..|..|.::
Zfish   295 LIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPSWVHTVFLRALPRIMLMRRPLDLSE 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/15 (27%)
Neur_chan_LBD 212..429 CDD:280998 41/226 (18%)
chrna6NP_001036149.1 LIC 38..504 CDD:273305 70/362 (19%)
Neur_chan_LBD 38..233 CDD:280998 44/237 (19%)
Neur_chan_memb 240..503 CDD:280999 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.