DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and tsen54

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021326404.1 Gene:tsen54 ZFINID:ZDB-GENE-050522-454 Length:504 Species:Danio rerio

Alignment Length:148 Identity:35/149 (23%)
Similarity:53/149 (36%) Gaps:57/149 (38%)


  Fly   229 NASMPANLSSISFH--------FQTRSLAY---------------EQTSSLLQTRMHMMMHW--- 267
            :||..|......:|        |:.||.::               ||.|..||..:.  .||   
Zfish     5 DASADAGNKQSVYHELLSPSELFEARSRSHKIPVRGQKEFLPSGSEQQSQRLQHSLE--EHWTLL 67

  Fly   268 ---RDSRL------VWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMG------QVLQSYE-L 316
               |..||      ||.||:  .|...:.|..:.|           |:||      |.||..| |
Zfish    68 AEERVERLGNLVNAVWSPEE--KLVELQSPAGKFW-----------QTMGFSERGKQYLQPEEAL 119

  Fly   317 MVYANGSITLYAQNLQLA 334
            .:...|::.::.::|.|:
Zfish   120 YLMECGNVQVFYRDLPLS 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 35/149 (23%)
tsen54XP_021326404.1 tRNA_int_end_N2 64..131 CDD:315583 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.