DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001017885.1 Gene:chrna5 ZFINID:ZDB-GENE-050417-440 Length:466 Species:Danio rerio

Alignment Length:513 Identity:94/514 (18%)
Similarity:171/514 (33%) Gaps:163/514 (32%)


  Fly   175 PLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTE-KLLSHLNIQAENASMPANLSS 238
            |||.:.:..|:.|                   .|::....||| ||..||....:....|  :..
Zfish    13 PLVCSAVLCSAIG-------------------PPMLSSYAKTEDKLFKHLFSNYQKWVRP--IED 56

  Fly   239 ISFHFQTR-SLAYEQ------TSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPH 296
            ::...|.: .||..|      .:.|:.|.:.|...|.|.:|.|.|:.:..:.|...|...||.|.
Zfish    57 LNTTIQVKFGLAISQLVDVDEKNQLMTTNVWMKQEWTDLKLRWDPDHYLGITSIRVPSDSIWIPD 121

  Fly   297 MNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQE 361
            :.:.:.|..:....:.  :.:|..:|:|: :.......|.|......:|.:...|.::.|     
Zfish   122 IVLYDNADGNFEATVT--KAVVRFDGTIS-WTPPANYKSACTIDVTFFPFDLQNCSMKFG----- 178

  Fly   362 GQENVALIYDDQRKPIAPNEHVNTPSGWSF--TQMSVVLVE-NDSQRRYNPKGMMQ--KMTGD-- 419
                                      .|::  :|:.::|.: :..:|.|...|..:  |.||:  
Zfish   179 --------------------------SWTYDGSQVDILLEDVHVDKRDYFDNGEWEIVKATGNRG 217

  Fly   420 -----------VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSL---ILIALL 468
                       :...|.::|...||.....:|.|......:|.|.|.|.  .:.||   :|::|.
Zfish   218 LRRDGTFFYPSITYSFIIRRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNGGEKISLCTSVLVSLT 282

  Fly   469 IAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY-----PPRSKAPGWLVR 528
            :  :.|:......|...|.|::..|.|..|......|: |.:..::::     ...|.|| |:.|
Zfish   283 V--FLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIV-ITVFAINIHHRSSSTHHSMAP-WVRR 343

  Fly   529 VINSNVLRCI---------------------LGLRFSDSTDYCDIQEN----------------- 555
            :...::.|.:                     .|...|..|:..|.:.|                 
Zfish   344 IFLHHLPRLLCMRSHVDRYATSAGTRTGGLGYGKSLSQDTNQLDAEHNLQAALESIRYITRHVVK 408

  Fly   556 ---------PWHHMAKILNN-----------LSSILV----------IITFAIVDITS 583
                     .|..:|::|:.           |.|.|:          ||..:..:|||
Zfish   409 ENEVREVVQDWKFVAQVLDRVFLWAFLLVSLLGSALLFIPVIYKWASIIVPSYAEITS 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/16 (31%)
Neur_chan_LBD 212..429 CDD:280998 45/243 (19%)
chrna5NP_001017885.1 LIC 12..448 CDD:273305 89/494 (18%)
Neur_chan_LBD 36..239 CDD:280998 43/239 (18%)
Neur_chan_memb 246..446 CDD:280999 36/204 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.