DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnd

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001015814.1 Gene:chrnd XenbaseID:XB-GENE-989975 Length:521 Species:Xenopus tropicalis

Alignment Length:541 Identity:96/542 (18%)
Similarity:177/542 (33%) Gaps:194/542 (36%)


  Fly   155 LFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKL 219
            :|.|..|...|      .|...::|::    ||..           ||..|:.|:  |.|.    
 Frog    12 IFSYFQGCLSE------SEEERLLNHI----FGER-----------GYRKELRPV--EHTG---- 49

  Fly   220 LSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLES 284
                  :..|.|:...||::        ::.::....|.|.:.:.:.|.|.||.|..|:|..:..
 Frog    50 ------ETVNVSLALTLSNL--------ISLKEADETLTTNVWVELGWYDKRLAWDMEEFHHINI 100

  Fly   285 FEHPDLRIWKPHM---NVLNGALQSMGQVLQSYELMVYANGSIT----LYAQNLQLASW------ 336
            ...|...:|:|.:   |..||.          :|:..|:|..:.    :|        |      
 Frog   101 IRVPPDMVWQPQLILENNNNGV----------FEVAYYSNVLVNSDGFMY--------WLPPAIF 147

  Fly   337 ---CVDSARNWPSERVTCDIE---LGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGW------ 389
               |..:...:|.:...|.::   |..|.:|  .|:.|..|...:     ...|.|..|      
 Frog   148 QTSCSINVNYFPFDWQNCSLKFSSLTYNAKE--INLQLRQDQDEE-----SQRNYPVEWIIIDPE 205

  Fly   390 SFT---QMSVVLV--ENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLI 449
            .||   :..:|.:  :.:..|...|:....:   |:.....::|...||:.....|.:...:...
 Frog   206 GFTENGEWEIVHIPAKKNIDRSLTPESTKYQ---DITFYLIIKRKPLFYIINILAPCVLIALMAN 267

  Fly   450 LSFVLRSTRRSSLIL-IALLIA--AWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICII 511
            |.|.|.:.....:.| |::|:|  .:.|:...|.....:..|:::.|.:.:|......::. |:|
 Frog   268 LVFYLPADSGEKMTLAISVLLAQSVFLLLISQRLPETSFAIPLISKYLMFIMVLVTIVVVS-CVI 331

  Fly   512 WLDLY-----------------------------------PP-------RSKAPGWLVRV----- 529
            .|:|:                                   .|       ||.:.|::|:.     
 Frog   332 VLNLHFRTPSTHVITERMKEIFLNKLPRILHMSRPAEPEPEPWSGVLLRRSSSVGYIVKAEEYYS 396

  Fly   530 -----------------------------INSN---------VLRCILGLRF-----SDSTDYCD 551
                                         :|||         :...|.|..|     .|..||.:
 Frog   397 VKSRSELMFEKQSERHGLTSRATPARVNPLNSNNSQDQLYGEIKPAIDGANFIVKHMRDKNDYNE 461

  Fly   552 IQENPWHHMAKILNNLSSILV 572
            .::| |:.:|:.::.|...||
 Frog   462 EKDN-WYRIARTVDRLCLFLV 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 8/36 (22%)
Neur_chan_LBD 212..429 CDD:280998 45/247 (18%)
chrndNP_001015814.1 Neur_chan_LBD 25..248 CDD:308532 52/286 (18%)
Neur_chan_memb 255..493 CDD:308533 37/230 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.