DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnd

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_062171.1 Gene:Chrnd RGDID:2352 Length:517 Species:Rattus norvegicus

Alignment Length:360 Identity:73/361 (20%)
Similarity:140/361 (39%) Gaps:54/361 (15%)


  Fly   174 APLVINYLSFSSFGSNTARWFYDCGFD--GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANL 236
            |.||:    ..|:|.|..:......|:  ||..|:.|:.::|...:..||            ..|
  Rat    12 AALVV----CGSWGLNEEQRLIQHLFEEKGYNKELRPVARKEDIVDVALS------------LTL 60

  Fly   237 SSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLN 301
            |::        ::.::....|.|.:.:...|.||||.|...:||::.....|...:|.|.: ||.
  Rat    61 SNL--------ISLKEVEETLTTNVWIDHAWIDSRLQWNANEFGNITVLRLPSDMVWLPEI-VLE 116

  Fly   302 GALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDI----------ELG 356
            .......|:..:..::|..:|.:|.....: ..|.|..|...:|.:...|.:          |:.
  Rat   117 NNNDGSFQISYACNVLVSDSGHVTWLPPAI-FRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIR 180

  Fly   357 LNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSV-VLVENDSQRRYNPKGMMQKMT-GD 419
            |:.::.:|      |::..||  ...:..|.|  ||:... .:|...::...:|...|.... .|
  Rat   181 LSLKQEEE------DNRSYPI--EWIIIDPEG--FTENGEWEIVHRAAKVNVDPSVPMDSTNHQD 235

  Fly   420 VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLR---STRRSSLILIALLIAAWGLMYMTRYA 481
            |.....::|...||:....:|.:.....:.|.|.|.   ..:.|..|.:.|..:.:.|:...|..
  Rat   236 VTFYLIIRRKPLFYIINILVPCVLISFMINLVFYLPGDCGEKTSVAISVLLAQSVFLLLISKRLP 300

  Fly   482 SPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY 516
            :.....|::..:.:..|......:: ||:|.|:::
  Rat   301 ATSMAIPLVGKFLLFGMVLVTMVVV-ICVIVLNIH 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/17 (35%)
Neur_chan_LBD 212..429 CDD:280998 45/229 (20%)
ChrndNP_062171.1 LIC 23..476 CDD:273305 68/346 (20%)
Neur_chan_LBD 25..246 CDD:280998 50/253 (20%)
Neur_chan_memb 253..489 CDD:280999 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.