DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnb2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_062170.1 Gene:Chrnb2 RGDID:2350 Length:500 Species:Rattus norvegicus

Alignment Length:380 Identity:87/381 (23%)
Similarity:148/381 (39%) Gaps:79/381 (21%)


  Fly   212 EETKTEKLL--SHLNIQAENASMPANLSSISFHFQTRSL-AYEQTSSLLQTRMHMMMHWRDSRLV 273
            ||...|.||  |..|.....|:..:.|.::........| :..:...::.|.:.:...|.|.||.
  Rat    28 EERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLT 92

  Fly   274 WKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN------GSI-----TLY 327
            ||||||.:::....|...||.|.:.:.|.| ..|      ||:..|:|      |||     .:|
  Rat    93 WKPEDFDNMKKVRLPSKHIWLPDVVLYNNA-DGM------YEVSFYSNAVVSYDGSIFWLPPAIY 150

  Fly   328 --AQNLQLASW------CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVN 384
              |..:::..:      |....|:|..:|...|:.|       :.:||.:.|            .
  Rat   151 KSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVL-------KSDVASLDD------------F 196

  Fly   385 TPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFL 448
            |||| |.       ::....:|..||.   .....|:..:|.::|...||.....:|.:......
  Rat   197 TPSGEWD-------IIALPGRRNENPD---DSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLA 251

  Fly   449 ILSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVP-PMMTAYKVI-MMTTTYCYILHIC 509
            ||.|.|.|.  .:.:|.:..||.....|:.:::...|..:. |::..|.:. |:..|:..:..:|
  Rat   252 ILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVC 316

  Fly   510 IIWLDLYPP--RSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAK 562
            ::.:....|  .:.|| | |:|:....|..:|.|            :.|.|..|:
  Rat   317 VLNVHHRSPTTHTMAP-W-VKVVFLEKLPTLLFL------------QQPRHRCAR 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 57/240 (24%)
Chrnb2NP_062170.1 LIC 28..477 CDD:273305 87/381 (23%)
Neur_chan_LBD 28..233 CDD:280998 57/241 (24%)
Neur_chan_memb 240..476 CDD:280999 28/133 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.