DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna10

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001074893.1 Gene:Chrna10 MGIID:3609260 Length:447 Species:Mus musculus

Alignment Length:387 Identity:82/388 (21%)
Similarity:142/388 (37%) Gaps:73/388 (19%)


  Fly   160 PGFKKEPLLQFIDEAPLVINYLSFSSFGSN---TARWFYDCGFDGYGSEIAPIVKEETKTEKLLS 221
            |||             |::.:|.....|:.   ..:.|.|. |..|.|.:.|:...:        
Mouse    10 PGF-------------LLLLFLPAECLGAEGRLAHKLFRDL-FANYTSALRPVADTD-------- 52

  Fly   222 HLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFE 286
                |..|.::...||.|        :..::.:.:|...:.:...|.|:.|.|.|:.:|.|::..
Mouse    53 ----QTLNVTLEVTLSQI--------IDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIR 105

  Fly   287 HPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTC 351
            .|...:|:|.:.:.|.| .:......|..::|..:|::...|..:..:|..||.:. :|.:...|
Mouse   106 IPSSLVWRPDIVLYNKA-DTQPPASASTNVVVRHDGAVRWDAPAITRSSCRVDVSA-FPFDAQRC 168

  Fly   352 DIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVV-LVEN--------DSQRRY 407
            .:..|.....|.:.      |.|           |.|   |..|:. .|||        .::||.
Mouse   169 GLTFGSWTHGGHQL------DVR-----------PRG---TSASLADFVENVEWRVLGMPARRRV 213

  Fly   408 NPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL--RSTRRSSL-ILIALLI 469
            ...|...:...||.....|:|..:.|:....||.:...:...|:|.|  .|..:.|| :.:.|.:
Mouse   214 LTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLAL 278

  Fly   470 AAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRS-KAPGWLVRVI 530
            ..:.|:..........||.:...|...|...|:...|.|.|:.|....|.: ..|.| .||:
Mouse   279 TVFQLILAESMPPAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAW-ARVL 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/34 (18%)
Neur_chan_LBD 212..429 CDD:280998 45/226 (20%)
Chrna10NP_001074893.1 Neur_chan_LBD 32..235 CDD:280998 51/246 (21%)
Neur_chan_memb 243..437 CDD:280999 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.