DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and ort

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_524406.1 Gene:ort FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster

Alignment Length:339 Identity:66/340 (19%)
Similarity:130/340 (38%) Gaps:107/340 (31%)


  Fly   239 ISFHFQTRSL-AYEQTSSLLQTRMHMMMHWRDSRL--------------------VWKPEDFGSL 282
            :.||.....| :.::.|......:.....|:|.||                    :|:|:.|   
  Fly    55 VYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLPENMTQEYRLLEVDWLKNMWRPDSF--- 116

  Fly   283 ESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSE 347
                         ..|..:...|:|  .:.::.:.:|.:.:| ||...|.|...|:.:...:|.:
  Fly   117 -------------FKNAKSVTFQTM--TIPNHYMWLYKDKTI-LYMVKLTLKLSCIMNFAIYPHD 165

  Fly   348 RVTCDIELGLNGQEGQENVA-----LIYD-DQRKPIAPNEHVNTPSGWSFTQMSVVLVEN---DS 403
            ...|.:::        |:::     ||:. |...|:..:|::..|        .|.|:.|   |.
  Fly   166 TQECKLQM--------ESLSHTTDDLIFQWDPTTPLVVDENIELP--------QVALIRNETADC 214

  Fly   404 QRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL------RSTRR 459
            .:.|:        ||:   :.:.|||:|...:|:...|:|  .| |.:|:|:|.      .:..|
  Fly   215 TQVYS--------TGNFTCLEVVFTLKRRLVYYVFNTYIP--TC-MIVIMSWVSFWIKPEAAPAR 268

  Fly   460 SSLILIALLIAAWGLMYMTRYA-SPHYVPPM-----MTAYKVIMMTTTYCYILHICIIWLDL--- 515
            .:|.:.:||..:      |::| |...:||:     :.|:..:.....:..::..|:|.:.|   
  Fly   269 VTLGVTSLLTLS------TQHAKSQSSLPPVSYLKAVDAFMSVCTVFVFMALMEYCLINIVLSDT 327

  Fly   516 -------YPPRSKA 522
                   |||:..|
  Fly   328 PIPKPMAYPPKPVA 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/223 (18%)
ortNP_524406.1 LIC 31..481 CDD:273305 66/340 (19%)
Neur_chan_LBD 38..235 CDD:280998 41/223 (18%)
Neur_chan_memb 243..>334 CDD:280999 20/100 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.