DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glrbb

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021336678.1 Gene:glrbb ZFINID:ZDB-GENE-040801-106 Length:502 Species:Danio rerio

Alignment Length:233 Identity:50/234 (21%)
Similarity:89/234 (38%) Gaps:39/234 (17%)


  Fly   251 EQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQ- 312
            ::|:...:..:.:...|.|.|| ..|:||.|......|.:  .:|||.:...|....:...|.| 
Zfish   103 QETTMDYRVNIFLRQRWNDPRL-RLPQDFKSDSLTVDPKMFKCLWKPDLFFANEKSANFHDVTQE 166

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR--- 374
            :..|.::.||.: |.:..|.:...|......:|.:...|.::|        |:.....||.:   
Zfish   167 NILLFIFRNGDV-LISMRLSVTLSCPLDLTLFPMDTQRCKMQL--------ESFGYTTDDLQFMW 222

  Fly   375 ---KPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKM---TG---DVAIEFTLQRNR 430
               .|:..:|              :.|.:.|.::.....|...|.   ||   .|.:.|||:|..
Zfish   223 QSGDPVQMDE--------------IALPQFDIKQEDIEYGNCTKYYAGTGYYTCVEVIFTLRRQV 273

  Fly   431 SFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALL 468
            .|||...|.|.:...:...|||.:.....::.:.:.:|
Zfish   274 GFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIL 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/193 (21%)
glrbbXP_021336678.1 Neur_chan_LBD 53..501 CDD:332142 50/234 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.