DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and GLRA4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001019623.2 Gene:GLRA4 HGNCID:31715 Length:417 Species:Homo sapiens

Alignment Length:317 Identity:71/318 (22%)
Similarity:123/318 (39%) Gaps:90/318 (28%)


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRM---- 261
            ||.:.|.|               |.:....::..|:...||            ||:.:|.|    
Human    57 GYDARIRP---------------NFKGPPVNVTCNIFINSF------------SSITKTTMDYRV 94

  Fly   262 --HMMMHWRDSRLVWK--PEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQSYELM-VY 319
              .:...|.|.||.::  |:|...|:    |.:  .||||.:...|....:..:|....:|: ::
Human    95 NVFLRQQWNDPRLSYREYPDDSLDLD----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIF 155

  Fly   320 ANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVN 384
            .||:: ||:..|.|...|:...:|:|.:..||.::|...|...::.|....:|     ||  .|.
Human   156 KNGNV-LYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWLED-----AP--AVQ 212

  Fly   385 TPSGWSFTQMSVVLVEND---SQRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLIA 443
            ...|.:..|. ::..|.|   ..:.||        ||.   :.::|.|:|...:|:...|:|   
Human   213 VAEGLTLPQF-ILRDEKDLGCCTKHYN--------TGKFTCIEVKFHLERQMGYYLIQMYIP--- 265

  Fly   444 CQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
                             ||:::   |.:|...::...|:|..|...:|.  |:.|||
Human   266 -----------------SLLIV---ILSWVSFWINMDAAPARVGLGITT--VLTMTT 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/234 (22%)
GLRA4NP_001019623.2 Neur_chan_LBD 48..255 CDD:280998 56/246 (23%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 237..242 4/13 (31%)
Neur_chan_memb 262..>347 CDD:280999 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.