DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRbeta2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_524483.1 Gene:nAChRbeta2 FlyBaseID:FBgn0004118 Length:519 Species:Drosophila melanogaster

Alignment Length:407 Identity:78/408 (19%)
Similarity:139/408 (34%) Gaps:104/408 (25%)


  Fly   185 SFGSN--TARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRS 247
            ||.:|  |.| .||.....|...|.|:|   ..||.|...|.::.... :..||.          
  Fly    23 SFEANPDTKR-LYDDLLSNYNRLIRPVV---NNTETLTVWLGLKLSQL-IEVNLK---------- 72

  Fly   248 LAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ 312
                  :.::.|.:.:...|.|.:|.|.||::|.:|....|...||.|.:.:.|....:....|.
  Fly    73 ------NQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLM 131

  Fly   313 SYELMVYANGSI-----TLYAQNLQLASWCVDSARNWPSERVTCDIELG---LNGQEGQENVALI 369
            :...:.| .|.:     .:|      .|.|..:...:|.:...|.::.|   .||.:    |.| 
  Fly   132 TKATLKY-TGEVFWEPPAIY------KSSCEMNVEYFPYDEQICFMKFGSWTYNGAQ----VDL- 184

  Fly   370 YDDQRKPIAPNEHVNTPSGWSFTQMSVVLVE-------------NDSQRRYNPKGMMQKMTGDVA 421
                       :|::...|.:..|:.:.|.|             ......|.|..:  :...|:.
  Fly   185 -----------KHLDQIPGSNLVQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTL--EPFSDIT 236

  Fly   422 IEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYV 486
            .:.|::|...||.....:|.:|.....:|.|.|.|.....:.|...::.:..:.::   .....:
  Fly   237 FKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFL---LLAEII 298

  Fly   487 PPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRF-SDSTDYC 550
            ||...|..::.....:..||....:|..:                     |:|.:.| |.||   
  Fly   299 PPTSLAVPLLGKYLLFTMILVSLSVWTTV---------------------CVLNIHFRSPST--- 339

  Fly   551 DIQENPWHHMAKILNNL 567
                   |:|:.::..|
  Fly   340 -------HNMSPLVRKL 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/8 (50%)
Neur_chan_LBD 212..429 CDD:280998 43/238 (18%)
nAChRbeta2NP_524483.1 LIC 9..479 CDD:273305 78/408 (19%)
Neur_chan_LBD 31..245 CDD:280998 50/260 (19%)
Neur_chan_memb 252..479 CDD:280999 22/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.