DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_524482.1 Gene:nAChRalpha2 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster

Alignment Length:411 Identity:76/412 (18%)
Similarity:146/412 (35%) Gaps:114/412 (28%)


  Fly   191 ARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSS 255
            |:..||.....|...|.|:   ...|:.:|..|.::.... :..||.                ..
  Fly    45 AKRLYDDLLSNYNRLIRPV---SNNTDTVLVKLGLRLSQL-IDLNLK----------------DQ 89

  Fly   256 LLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA-----LQSMGQVLQSYE 315
            :|.|.:.:...|:|.:..|.|.::|.:.....|...||.|.:.:.|.|     :.:|.:.:..| 
  Fly    90 ILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHY- 153

  Fly   316 LMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQE----NVALIYD-DQRK 375
                 .|.: ::.......|.|....|.:|.::.||.::.|....:|.:    :::...| |.:.
  Fly   154 -----TGKV-VWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKV 212

  Fly   376 PIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFY------- 433
            .|..:.....||    .:..::.|..:...:|.|  ...:...|:....||:|...||       
  Fly   213 EIGIDLREYYPS----VEWDILGVPAERHEKYYP--CCAEPYPDIFFNITLRRKTLFYTVNLIIP 271

  Fly   434 --------MTVFYLP--------------LIACQMFLILSFVLRSTRRS----------SLILIA 466
                    :.|||||              |.....||::|.::.||..:          :::|:.
  Fly   272 CVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVG 336

  Fly   467 LLIAAWGLMYMTRYASP--HYVPPMMTAY------KVIMMTTTYCYILHICIIWLDLYPPRSKAP 523
            |.:....::....|..|  |.:.|.:.::      |:::|                      :.|
  Fly   337 LSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLM----------------------RVP 379

  Fly   524 GWLVRVINSNVLRCILGLRFS 544
            ..|:|.:.:|.:.  .||:||
  Fly   380 KDLLRDLAANKIN--YGLKFS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 76/412 (18%)
Neur_chan_LBD 212..429 CDD:280998 41/227 (18%)
nAChRalpha2NP_524482.1 Neur_chan_LBD 45..261 CDD:280998 47/249 (19%)
LIC 47..544 CDD:273305 75/410 (18%)
Neur_chan_memb 268..543 CDD:280999 27/156 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.