DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001262916.1 Gene:nAChRalpha1 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster

Alignment Length:379 Identity:77/380 (20%)
Similarity:139/380 (37%) Gaps:77/380 (20%)


  Fly   181 LSFSSFG--SNTARWFYDCGFDGYGSEIAPIVKEETK-TEKL---LSHLNIQAENASMPANLSSI 239
            |.|::.|  :..|:..||.....|...|.|:.....: |.|:   ||.|        :..||.  
  Fly    13 LHFATGGLANPDAKRLYDDLLSNYNRLIRPVGNNSDRLTVKMGLRLSQL--------IDVNLK-- 67

  Fly   240 SFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGAL 304
                          :.::.|.:.:...|.|.:|.|.|:|:|.:::...|...||.|.:.:.|.| 
  Fly    68 --------------NQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNA- 117

  Fly   305 QSMGQVLQSYELMVYANGSI-----TLYAQNLQLASWCVDSARNWPSERVTCDIELG-------- 356
            ....:|....:.:::..|.:     .:|      .|:|......:|.:..||.::.|        
  Fly   118 DGNYEVTIMTKAILHHTGKVVWKPPAIY------KSFCEIDVEYFPFDEQTCFMKFGSWTYDGYM 176

  Fly   357 -----LNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKM 416
                 |......:|:.:..|.|...|:..        |..  |.|..|.|  ::.|:   ..::.
  Fly   177 VDLRHLKQTADSDNIEVGIDLQDYYISVE--------WDI--MRVPAVRN--EKFYS---CCEEP 226

  Fly   417 TGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRS---TRRSSLILIALLIAAWGLMYMT 478
            ..|:....||:|...||.....:|.:......:|.|.|.|   .:.|..|.|.|.:..:.|:...
  Fly   227 YLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAE 291

  Fly   479 RYASPHYVPPMMTAYKVI-MMTTTYCYILHICIIWLDLYPP--RSKAPGWLVRV 529
            .........|::..|.:. ||..|...::.|.::.::...|  ...|| |:.|:
  Fly   292 IIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAP-WVQRL 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 3/12 (25%)
Neur_chan_LBD 212..429 CDD:280998 45/239 (19%)
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 51/261 (20%)
LIC 27..530 CDD:273305 73/366 (20%)
Neur_chan_memb 247..530 CDD:280999 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.