DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and GluClalpha

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001287408.1 Gene:GluClalpha FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster

Alignment Length:205 Identity:42/206 (20%)
Similarity:82/206 (40%) Gaps:51/206 (25%)


  Fly   267 WRDSRLVWKPEDF-GSLESFEHPDL-RIWKPHM---NVLNGALQSMGQVLQSYELMVYANGSITL 326
            |.|.||  |.:|. |.|:.....:. |:|.|.:   |...|...::  ::.:..:.::.|||: |
  Fly    93 WTDERL--KFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNI--IMPNVYIRIFPNGSV-L 152

  Fly   327 YAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF 391
            |:..:.|...|..:.:.:|.:|..|.:.:...|....:.|.|..:.....:..|.|:        
  Fly   153 YSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHL-------- 209

  Fly   392 TQMSVVLVENDSQRRYNPKGMMQKM----------TGD---VAIEFTLQRNRSFYMTVFYLPLIA 443
                             |:..::|.          ||:   :.::...:|..|:|:...|:|   
  Fly   210 -----------------PRFTLEKFLTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIP--- 254

  Fly   444 CQMFLILSFV 453
            |.|.:|:|:|
  Fly   255 CCMLVIVSWV 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 33/180 (18%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 42/206 (20%)
Neur_chan_LBD 33..241 CDD:280998 32/178 (18%)
Neur_chan_memb 251..452 CDD:280999 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.