DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and HisCl1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_731632.1 Gene:HisCl1 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster

Alignment Length:317 Identity:60/318 (19%)
Similarity:117/318 (37%) Gaps:77/318 (24%)


  Fly   211 KEETKTEKLLSHLNIQAENASMPANL-------------------SSISFHFQTRSL-AYEQTSS 255
            :..|::.:|:||..   .:.|:|..|                   :.:.||....|| :..:.|.
  Fly    38 RNNTESAELVSHYE---SSLSLPDILPIPSKTYDKNRAPKLLGQPTVVYFHVTVLSLDSINEESM 99

  Fly   256 LLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDL----RIWKPHMNVLNGALQSMGQV-LQSYE 315
            ...|.:.:...|||.|| ..||:..  |.:...|:    .||:|.....|....:..:: :.::.
  Fly   100 TYVTDIFLAQSWRDPRL-RLPENMS--EQYRILDVDWLHSIWRPDCFFKNAKKVTFHEMSIPNHY 161

  Fly   316 LMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPN 380
            |.:|.:.:: ||...|.|...|.....::|.:...|.:.:. :.....|::..|: :...|:..|
  Fly   162 LWLYHDKTL-LYMSKLTLVLSCAMKFESYPHDTQICSMMIE-SLSHTVEDLVFIW-NMTDPLVVN 223

  Fly   381 EHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLI 442
            ..:..|             :.|....|.....::..||:   :||.|.|:|...:::...|:|  
  Fly   224 TEIELP-------------QLDISNNYTTDCTIEYSTGNFTCLAIVFNLRRRLGYHLFHTYIP-- 273

  Fly   443 ACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMT 499
                             |:||::...|:.|        ..|..:|..:|.....::|
  Fly   274 -----------------SALIVVMSWISFW--------IKPEAIPARVTLGVTSLLT 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/245 (20%)
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 42/214 (20%)
Neur_chan_memb 270..>350 CDD:280999 11/64 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.