DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001097669.2 Gene:nAChRalpha4 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster

Alignment Length:390 Identity:72/391 (18%)
Similarity:135/391 (35%) Gaps:113/391 (29%)


  Fly   187 GSNTARWFYDCGFDGYGSEIAPIVKEETKTE-----KLLSHLNIQAENASMPANLSSISFHFQTR 246
            |:..|:..||.....|...:.|:|......:     ||...:::..:|..|            |.
  Fly     8 GNPDAKRLYDDLLSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIM------------TT 60

  Fly   247 SLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVL 311
            :|..||:             |.|.:|.|:|:::|.:.....|...||:|.:.:.|.| ....:|.
  Fly    61 NLWVEQS-------------WYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNA-DGNFEVT 111

  Fly   312 QSYELMVYANGSITLYAQNLQLASW---------CVDSARNWPSERVTCDIELG----------- 356
            .:.:..:|:.|          |..|         |......:|.:..||.::.|           
  Fly   112 LATKATIYSEG----------LVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDL 166

  Fly   357 --LNGQEGQENVA-----------LIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYN 408
              ::.|:|...||           :.:|....|...||...|.....:.                
  Fly   167 RHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYL---------------- 215

  Fly   409 PKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLIL-IALLIA-- 470
                      |:....|::|...||.....:|.:......:|:|.|.|.....:.| |::||:  
  Fly   216 ----------DITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLH 270

  Fly   471 AWGLMYMTRYASPHYVPPMMTAYKV---IMMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRV 529
            .:.|:.:........|.|::..|.:   |:::.:.|    :.::.|:::   |...|...|:.||
  Fly   271 VFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISIC----VTVVVLNVHFRSPQTHKMAPWVKRV 331

  Fly   530  529
              Fly   332  331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 1/4 (25%)
Neur_chan_LBD 212..429 CDD:280998 42/255 (16%)
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 72/391 (18%)
Neur_chan_LBD 12..227 CDD:280998 48/277 (17%)
Neur_chan_memb 234..505 CDD:280999 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.