DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnd

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_996947.1 Gene:chrnd ZFINID:ZDB-GENE-030131-6665 Length:518 Species:Danio rerio

Alignment Length:378 Identity:75/379 (20%)
Similarity:139/379 (37%) Gaps:83/379 (22%)


  Fly   167 LLQFI-------DEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLN 224
            ||.||       :|...:||||            |.:   .||..|:.|:   :.|.|.:..:|.
Zfish    11 LLCFIFQECCGRNEEERLINYL------------FKE---RGYNKELRPV---QNKDETVDIYLA 57

  Fly   225 IQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPD 289
            :...|.                 ::.::....|.|.:.|...|:|.||.|...:: .:.....|.
Zfish    58 LTLSNL-----------------ISLKEVDETLLTNVWMEHGWKDHRLTWNESEY-DIPVLRLPP 104

  Fly   290 LRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDI- 353
            ..:|.|.: ||.....:..||.....:::|::|.: .:.......|.|..:...:|.:...|.: 
Zfish   105 SMVWLPEI-VLENNNDAQFQVAYYCNVLIYSSGDM-YWLPPAIFRSSCSINVNYFPFDWQNCSLK 167

  Fly   354 ---------ELGLNGQEGQENVA------LIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDS 403
                     |:.||.:..|||..      :|.|              |.|  ||:.....:.:..
Zfish   168 FSSLTYNAKEISLNLKMEQENTTYYKVEWIIID--------------PEG--FTENGEWEIVHKP 216

  Fly   404 QRRYNPKGMMQKMT--GDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLIL-I 465
            .||...|.:.::..  .|:.....::|...||:....:|.:.......|.:.|.:.....:.| |
Zfish   217 ARRNIYKSIPKESNKHQDITFYLIIKRKPLFYIVNIIIPCVLISFLASLVYYLPADSGEKMTLSI 281

  Fly   466 ALLIA--AWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY 516
            ::|:|  .:.|:...|........|::..|.:.:|......:|: |:|.|:|:
Zfish   282 SVLLAQSVFLLLISQRLPETSMAVPLIVKYLMFIMVLVTVVVLN-CVIVLNLH 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 9/31 (29%)
Neur_chan_LBD 212..429 CDD:280998 42/235 (18%)
chrndNP_996947.1 LIC 6..493 CDD:273305 75/379 (20%)
Neur_chan_LBD 25..245 CDD:280998 51/274 (19%)
Neur_chan_memb 252..490 CDD:280999 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.