DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Grd

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_524131.1 Gene:Grd FlyBaseID:FBgn0001134 Length:686 Species:Drosophila melanogaster

Alignment Length:537 Identity:100/538 (19%)
Similarity:168/538 (31%) Gaps:173/538 (32%)


  Fly    63 RELSNNNRKAGERLHLKFYVLTAMDAHILLSVTNHPRPNDRVYEIVIGAGGNTFSAIRNAMGMRR 127
            |.||::.   |:|.:|:.:.|......::|.:    .||  .:...||.|...||...:::..|.
  Fly    24 RSLSSHQ---GQRSNLRIFKLLISCCLLMLCI----YPN--AWPWSIGPGSGPFSVSADSIKGRG 79

  Fly   128 VATNQEPNLVSLYDPTPIEIVQNQNGELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTAR 192
            ..........||....|...:...|                          |:.:.|....|..|
  Fly    80 DTHRLGEMGTSLSSSLPSSWLTQSN--------------------------NHANISELLDNLLR 118

  Fly   193 WFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA----YEQT 253
                    ||.:.|.|                   :....||   :|......||:.    .:.|
  Fly   119 --------GYDNSIRP-------------------DFGGPPA---TIEVDIMVRSMGPISEVDMT 153

  Fly   254 SSLLQTRMHMMMHWRDSRLVWK-PEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSY--- 314
            .|:   ..:....|.|.||.:: .:|  :|........|||||.....||.        |||   
  Fly   154 YSM---DCYFRQSWVDKRLAFEGAQD--TLALSVSMLARIWKPDTYFYNGK--------QSYLHT 205

  Fly   315 ------ELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQ 373
                  .:.:|.||.: ||:..|.:.:.|..:..::|.:...|.::.|..|.. ..:|...::.:
  Fly   206 ITTPNKFVRIYQNGRV-LYSSRLTIKAGCPMNLADFPMDIQKCPLKFGSFGYT-TSDVIYRWNKE 268

  Fly   374 RKPIAPNEH--------VNTPSGWSFTQMSVVLVENDSQRR-YNPK------------------- 410
            |.|:|..|.        |:.|:| :.|.:.........||| :|.|                   
  Fly   269 RPPVAIAEDMKLSQFDLVDCPAG-NLTDIVYKAAAPRPQRRPFNNKDPPRPTSKVMTTFAGPAAK 332

  Fly   411 --------------------------GMMQKMTGDVAIE-------------FTLQRNRSFYMTV 436
                                      |....::|.:.:|             |.|||:...::..
  Fly   333 NQHVRGTGLKLDKGAFGTGRDATGGSGSTTGLSGTITLETNHPSEYSMLMVNFHLQRHMGNFLIQ 397

  Fly   437 FYLPLIACQMFLILSFV-------LRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYK 494
            .|.|   |.:.::||:|       ..:.|.|..|...|.:...||...|......| |..:..:.
  Fly   398 VYGP---CCLLVVLSWVSFWLNREATADRVSLGITTVLTMTFLGLEARTDLPKVSY-PTALDFFV 458

  Fly   495 VIMMTTTYCYILHICII 511
            .:.....:..||...::
  Fly   459 FLSFGFIFATILQFAVV 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 16/101 (16%)
Neur_chan_LBD 212..429 CDD:280998 55/298 (18%)
GrdNP_524131.1 Neur_chan_LBD 110..326 CDD:280998 55/262 (21%)
LIC 111..670 CDD:273305 78/416 (19%)
Neur_chan_memb 398..667 CDD:280999 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.