DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CG7589

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001261986.1 Gene:CG7589 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster

Alignment Length:313 Identity:62/314 (20%)
Similarity:126/314 (40%) Gaps:66/314 (21%)


  Fly   212 EETKTEKLLSHLNIQAENASMPANLSS----ISFHFQTRSLAY---EQTSSLLQTRMH--MMMHW 267
            ::|:..:.|:|: .:.:....|....|    :....:||...|   ...|.|||.:||  :.:.:
  Fly    43 QQTQLIQRLTHV-CRYDRLERPFEYDSDGKRLPIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRF 106

  Fly   268 RDSRLVWKPEDFGSLESF---EHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN----GSIT 325
            :|.||.:|.  |...::.   :|...|:|.||:...|   :....:|.:.|..|..:    |:: 
  Fly   107 QDKRLAYKA--FNRSDNILGQKHLSERLWLPHIFFAN---ERESSILGTDEKDVLTSLSPEGNV- 165

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVA-LIYD-DQRKPIAPNEHV----- 383
            :.:..:|.:.:|..:.:.:|.::..|...|    :....|.: ||.: :...||:.:..:     
  Fly   166 IISTRMQASLYCWMNFQKFPFDQQFCSTVL----ESWMYNTSDLILEWEPHTPISFDPEMRLTEY 226

  Fly   384 NTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFL 448
            |....|..|  ::|..:.|:.|.    |........::....|:|...||:..:|||        
  Fly   227 NMAQFWHNT--TIVQSDGDNLRH----GAFAGNYSSLSFTVNLKREIGFYLLDYYLP-------- 277

  Fly   449 ILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTT 501
                        |::::|:   :|...::...|||   |.:|.....::...|
  Fly   278 ------------SMMIVAI---SWVSFWLQADASP---PRIMLGTSTMLSFIT 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 48/240 (20%)
CG7589NP_001261986.1 LIC 43..505 CDD:273305 62/314 (20%)
Neur_chan_LBD 44..267 CDD:280998 48/240 (20%)
Neur_chan_memb 275..503 CDD:280999 12/65 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.