DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna1.2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_012825723.1 Gene:chrna1.2 XenbaseID:XB-GENE-5932067 Length:457 Species:Xenopus tropicalis

Alignment Length:505 Identity:93/506 (18%)
Similarity:175/506 (35%) Gaps:167/506 (33%)


  Fly   170 FIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPA 234
            ||...|:      |||  .:..|...|. |..|...:.|:   ||..::::..:.:|.       
 Frog    12 FIAAGPV------FSS--DHETRLIGDL-FANYNKVVRPV---ETYKDQVVVTVGLQL------- 57

  Fly   235 NLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNV 299
                      .:.:..::.:.::.|.:.:...|.|..|.|.|..:|.::....|...:|.|.:.:
 Frog    58 ----------IQLINVDEVNQIVSTNIRLKQQWVDVNLKWDPAKYGGVKKLRIPSSEVWCPDLVL 112

  Fly   300 LNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQE 364
            .|.|..... :.:..::::...|.|| :.......|:|.....::|.::..|.::.|....:|  
 Frog   113 YNNADGDFA-ISKDTKILLEHTGKIT-WTPPAIFKSYCEIIVTHFPFDQQNCSMKFGTWTYDG-- 173

  Fly   365 NVALIYDDQRKPIAPNEHVNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQ-------------- 414
            .:.:|..|:.:|...|   ...|| |                      ||:              
 Frog   174 TLVVINPDRDRPDLSN---FMASGEW----------------------MMKDYRCWKHWVYYTCC 213

  Fly   415 --KMTGDVAIEFTLQRNRSFYMT---------------VFYLP-------------LIACQMFLI 449
              |...|:...|.|||...:::.               |||||             |::..:||:
 Frog   214 PDKPYLDITYHFVLQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLL 278

  Fly   450 LSFVLRSTRRSSLILI-------------ALLIAAWGLMYMTRYASP--HYVPPMMTAYKVIMMT 499
            :...|..:..|::.||             :::|..  ::..|.:.||  |.:||.:.  |:.:.|
 Frog   279 VIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITV--IVINTHHRSPSTHTMPPWVR--KIFIDT 339

  Fly   500 --------------------TTYCYILHICIIWLDLYP-------PRSKAPGWLVRVINSNVLRC 537
                                ||:...:.|..|...|.|       |..|         |.:|...
 Frog   340 IPNIMFFSTMKRPSQEKQPQTTFAEEMDISDISGKLGPAAVTYQSPALK---------NPDVKSA 395

  Fly   538 ILGLRFSDSTDYCDIQEN----PWHHMAKILNNL-----SSILVIITFAI 578
            |.|:::...|...|.:.|    .|..:|.:|:::     .::.||.|.|:
 Frog   396 IEGIKYIAETMKSDQESNKASEEWKFVAMVLDHILLAVFMTVCVIGTLAV 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/21 (29%)
Neur_chan_LBD 212..429 CDD:280998 39/234 (17%)
chrna1.2XP_012825723.1 LIC 8..447 CDD:273305 93/506 (18%)
Neur_chan_LBD 24..231 CDD:280998 44/257 (17%)
Neur_chan_memb 238..446 CDD:280999 43/222 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.