DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Rdl

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001261617.1 Gene:Rdl FlyBaseID:FBgn0004244 Length:608 Species:Drosophila melanogaster

Alignment Length:339 Identity:69/340 (20%)
Similarity:121/340 (36%) Gaps:104/340 (31%)


  Fly   209 IVKEETKTEKLLSHLNIQAE--NASM--PANLSSISFHFQTRSLAYEQ----------------- 252
            ::.:||..:::  | .:||.  ..||  ..|:|:|...|   |::|::                 
  Fly    31 LIAQETGHKRI--H-TVQAATGGGSMLGDVNISAILDSF---SVSYDKRVRPNYGGPPVEVGVTM 89

  Fly   253 ----TSSLLQTRM------HMMMHWRDSRLVWKPE------DFGSLESFEHPDLRIWKPHMNVLN 301
                .|||.:.:|      :....|.|.||.::..      ..|| |..::    ||.|....:|
  Fly    90 YVLSISSLSEVKMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGS-EFIKN----IWVPDTFFVN 149

  Fly   302 GALQSMGQVLQSYE-LMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQEN 365
            ...........|.| :.|:.:|||| .:..|.:.:.|..:.:.:|.:|..|.||:...|.. ..:
  Fly   150 EKQSYFHIATTSNEFIRVHHSGSIT-RSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYT-MRD 212

  Fly   366 VALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMT---------GDVA 421
            :...:.|....:..:..|..|                   ::...|..|:.|         ..:|
  Fly   213 IRYFWRDGLSSVGMSSEVELP-------------------QFRVLGHRQRATEINLTTGNYSRLA 258

  Fly   422 IEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYV 486
            .|....|:..:|:...|:|                   |.||    :|.:|...::.|.|:|..|
  Fly   259 CEIQFVRSMGYYLIQIYIP-------------------SGLI----VIISWVSFWLNRNATPARV 300

  Fly   487 PPMMTAYKVIMMTT 500
            ...:|.  |:.|||
  Fly   301 ALGVTT--VLTMTT 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/264 (20%)
RdlNP_001261617.1 Neur_chan_LBD 61..>381 CDD:332142 60/307 (20%)
Neur_chan_memb 274..588 CDD:308533 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.