| Sequence 1: | NP_651958.2 | Gene: | NtR / 43935 | FlyBaseID: | FBgn0029147 | Length: | 585 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001317792.1 | Gene: | lgc-29 / 3896858 | WormBaseID: | WBGene00044528 | Length: | 398 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 284 | Identity: | 55/284 - (19%) | 
|---|---|---|---|
| Similarity: | 98/284 - (34%) | Gaps: | 72/284 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   267 WRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYA----NGSITLY 327 
  Fly   328 AQNLQLASWCVDSARNWPSERVTCDI----------ELGLNGQEGQENVALIYDDQRKPIAPNEH 382 
  Fly   383 VNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQM 446 
  Fly   447 FLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYV--------P-----PMMTAYKVIMM 498 
  Fly   499 TTTYCYILHICIIWLDLYPPRSKA 522 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| NtR | NP_651958.2 | Methyltransf_FA | 90..191 | CDD:289052 | |
| Neur_chan_LBD | 212..429 | CDD:280998 | 36/176 (20%) | ||
| lgc-29 | NP_001317792.1 | LIC | 38..>337 | CDD:273305 | 52/269 (19%) | 
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3645 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||