DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and lgc-29

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001317792.1 Gene:lgc-29 / 3896858 WormBaseID:WBGene00044528 Length:398 Species:Caenorhabditis elegans


Alignment Length:284 Identity:55/284 - (19%)
Similarity:98/284 - (34%) Gaps:72/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 WRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYA----NGSITLY 327
            |.|:||.|.|||:|.:.....|..::|.|...::: ...|..:|..: |...||    ||||.:|
 Worm   105 WYDTRLSWDPEDYGGINHIYVPRSKVWIPETTIVD-CFSSEIKVFDN-EYTRYAWLHSNGSIGMY 167

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDI----------ELGLNGQEGQENVALIYDDQRKPIAPNEH 382
            ..:: .:..|......:|.:..||.:          |..:.|:.|              ..|...
 Worm   168 IASV-TSVVCQMDVYKFPMDTHTCSVNFLFMTYQLEEFTIVGKTG--------------TLPRPV 217

  Fly   383 VNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQM 446
            ....:| |....:.:.         :.|  ::..:|.....|.|..||..||:.:..:|.....:
 Worm   218 EQLGNGEWQMKSIQIA---------FEP--VVDNLTYLTKFEATFSRNPGFYIVLVMIPAYFINV 271

  Fly   447 FLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYV--------P-----PMMTAYKVIMM 498
            ..|::..:....||....:.          ||...|..::        |     |::..|.|..:
 Worm   272 LSIVALFMDINNRSEKFTVG----------MTNIMSMSFILVILAEDLPKTKNLPILAIYTVTSL 326

  Fly   499 TTTYCYILHICIIWLDLYPPRSKA 522
            ....|.:..:..:      |:.||
 Worm   327 AIMLCSLTAVVAL------PKLKA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 36/176 (20%)
lgc-29NP_001317792.1 LIC 38..>337 CDD:273305 52/269 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.