DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRbeta1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster

Alignment Length:432 Identity:86/433 (20%)
Similarity:158/433 (36%) Gaps:91/433 (21%)


  Fly   176 LVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKL--------LSHLNIQAENASM 232
            ||:...|..|...:..|...|. |.||...|.|:   :..|:|:        :..:|:..:|..|
  Fly    14 LVLVAFSLVSASEDEERLVRDL-FRGYNKLIRPV---QNMTQKVGVRFGLAFVQLINVNEKNQIM 74

  Fly   233 PANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHM 297
            .:|                         :.:.:.|.|.:|.|...|:|.:.....|..::|||.:
  Fly    75 KSN-------------------------VWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDI 114

  Fly   298 NVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELG---LNG 359
            .:.|.| ....:|.....:::|..|.: |:.......|.|......:|.::.||.::.|   .||
  Fly   115 VLFNNA-DGNYEVRYKSNVLIYPTGEV-LWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNG 177

  Fly   360 QEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLV-------ENDSQRRYNPKGMMQKMT 417
            .  |.::|| |:::       ..|:....|......::.|       |.||.         ....
  Fly   178 D--QVSLAL-YNNK-------NFVDLSDYWKSGTWDIIEVPAYLNVYEGDSN---------HPTE 223

  Fly   418 GDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYM 477
            .|:.....::|...||.....||.:......:|.|.|.:.....:     ||::|::.   |:.:
  Fly   224 TDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVF---LLLV 285

  Fly   478 TRYASP-HYVPPMMTAYKV--IMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCIL 539
            ::...| ..|.|::..|.:  .:|.|....:..|.|.| :...||:......:|.|..:.|...|
  Fly   286 SKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINW-NFRGPRTHRMPMYIRSIFLHYLPAFL 349

  Fly   540 GLRFSDSTDYCDIQENPWHHM-----------AKILNNLSSI 570
            .::....|....:.|.|...|           |::..::|:|
  Fly   350 FMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAI 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/15 (27%)
Neur_chan_LBD 212..429 CDD:280998 42/235 (18%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 86/433 (20%)
Neur_chan_LBD 28..236 CDD:280998 49/258 (19%)
Neur_chan_memb 243..498 CDD:280999 31/154 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.