DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Glra4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_017457612.1 Gene:Glra4 RGDID:1564103 Length:495 Species:Rattus norvegicus

Alignment Length:308 Identity:69/309 (22%)
Similarity:122/309 (39%) Gaps:73/309 (24%)


  Fly   204 SEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWR 268
            |.:.|  |:.:....|:|..::..|:..|...|..||..::......:|              |.
  Rat    93 SNLGP--KDPSPCPPLISWTSLWDEHLDMMLGLGPISKDYRVNVFLRQQ--------------WN 141

  Fly   269 DSRLVWK--PEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQSYELM-VYANGSITLYA 328
            |.||.::  |:|...|:    |.:  .||||.:...|....:..:|....:|: ::.||:: ||:
  Rat   142 DPRLAYREYPDDSLDLD----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNV-LYS 201

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQ 393
            ..|.|...|....:|:|.:..||.::|...|....:.:....:|     ||  .|....|.:..|
  Rat   202 IRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLMFEWLED-----AP--AVQVAEGLTLPQ 259

  Fly   394 MSVVLVEND---SQRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSF 452
            . ::..|.|   ..:.||        ||.   :.::|.|:|...:|:...|:|            
  Rat   260 F-ILRDEKDLGYCTKHYN--------TGKFTCIEVKFHLERQMGYYLIQMYIP------------ 303

  Fly   453 VLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
                    ||:::   |.:|...::...|:|..|...:|.  |:.|||
  Rat   304 --------SLLIV---ILSWVSFWINMDAAPARVGLGITT--VLTMTT 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 51/228 (22%)
Glra4XP_017457612.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.