DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CG12344

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001286298.1 Gene:CG12344 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster

Alignment Length:356 Identity:69/357 (19%)
Similarity:125/357 (35%) Gaps:108/357 (30%)


  Fly   179 NYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAE-NASMPANL------ 236
            |..:|.|||         .||      |...:.|.|:     :|:|..|: ...:|.|.      
  Fly     6 NTNAFISFG---------LGF------ILMWLSEATE-----AHMNYTAKPRVVLPPNYVKEIRP 50

  Fly   237 -----SSISFHFQTRSLAYEQTSSL----LQTRMHMMMH--WRDSRL------VWKPEDFGSL-- 282
                 |.:...|   |:.....:|:    :..|:.|.:|  |.:|||      ..:.:|:.:|  
  Fly    51 PSKKGSPVIVDF---SIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLP 112

  Fly   283 ESFEHPDLRIWKPHMNVLNGALQSMGQVLQSY-ELMVYANGSITLYAQNLQLASWCVDSARNWPS 346
            |.||:    .|:|....||..:..:..:...: .:.:|.|.::. ||..:.....|....:.:|.
  Fly   113 EVFEN----FWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVR-YAARMHAIIACQMEFQLYPM 172

  Fly   347 ERVTCDIELGLNGQEGQENVALIYDDQRKPIAP-----NEHVNTPSGWSFTQMSVVLVENDSQRR 406
            :...|.|.:.......|: |.|.:.|....:.|     ..::..|         :.|.|:|.   
  Fly   173 DIQVCPIYIESFSSNNQK-VKLRWSDSGVTLNPELKLLQYNLGQP---------LELEESDG--- 224

  Fly   407 YNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLI 469
            |.|:  |...::|    :.|..:|....::...:.|                   |||:::....
  Fly   225 YMPEKVGNFSRLT----VYFRFERQIGHHLIQTFAP-------------------SSLVVMLSWF 266

  Fly   470 AAW-GLMYMTRYASPHYVPPMMTAYKVIMMT 499
            :.| ||         ..:|..:|.....|:|
  Fly   267 SFWLGL---------DAIPGRVTLLVTCMLT 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/12 (42%)
Neur_chan_LBD 212..429 CDD:280998 50/251 (20%)
CG12344NP_001286298.1 Neur_chan_LBD 8..441 CDD:332142 68/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.