DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-28

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001022053.1 Gene:lgc-28 WormBaseID:WBGene00044301 Length:397 Species:Caenorhabditis elegans

Alignment Length:355 Identity:71/356 (20%)
Similarity:116/356 (33%) Gaps:135/356 (38%)


  Fly   251 EQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESF---EHPDLR--IWKPHM---NVLNGA---- 303
            :....:|:..:.....|.|.||:|.|.::..:.:|   .|...|  .|.|.:   :|.|..    
 Worm    71 QDEQGVLKMALTFTFTWMDERLMWNPSNYSGIRTFSTTRHEMWRKKFWTPTLMMTDVPNSRRPSD 135

  Fly   304 ----------LQSMGQVLQSYELMV--------------YANGSITL----YAQNLQLASW-CVD 339
                      :.|.|.|..|..:|:              |.|.:.||    ||...:.|.| ..:
 Worm   136 VFKPFDMDIYISSSGMVRTSARMMLTIPCRTGFGSYPNDYKNCTFTLMSPYYADQFRFAQWGGAE 200

  Fly   340 SARNWPSERVTCDIELGLNGQE--------GQENVALIYDD--QRKPIAPNEHVNTPSGWSFTQM 394
            ..|...|.|||..::..|...:        |.|    :.||  :.||    .|..     ||.:.
 Worm   201 FTRYLMSSRVTDVLDFQLINIDTRNYYMFLGSE----VVDDFSKFKP----RHCR-----SFYRY 252

  Fly   395 SVVLVENDSQRRYNP-------------------KGMMQKMTGDVAIEFTLQRNRSFYMTVFY-- 438
            ::||      :|.|.                   .|.:....|.|.....|     .|.|:|.  
 Worm   253 NLVL------KRVNKFVSVQLIAPISVIAVFLAISGFLPHFYGLVCAGSAL-----VYETIFTYD 306

  Fly   439 -----------LPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYM-TR-----YASPHYV 486
                       :|:||    ::|.|:...|         :::.||.:..: ||     .|.|.|.
 Worm   307 VEQVLPKDYSGMPMIA----ILLCFLFAET---------IVLLAWKVFSINTRSHTVFTAFPEYF 358

  Fly   487 PPMMTAYKVIMMTTTYCYILHICIIWLDLY 516
            ...:|:.|..::.         .:||:|.:
 Worm   359 DDEITSKKEKLLK---------FVIWVDKF 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 50/248 (20%)
lgc-28NP_001022053.1 Neur_chan_LBD 62..>187 CDD:280998 23/116 (20%)
LIC 67..>329 CDD:273305 58/286 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.