DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and ZACN

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_851321.2 Gene:ZACN HGNCID:29504 Length:412 Species:Homo sapiens

Alignment Length:337 Identity:72/338 (21%)
Similarity:121/338 (36%) Gaps:90/338 (27%)


  Fly   180 YLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLS---SISF 241
            :|:|..| |.|....:..||.|..: |.|.:.....::|:...:.| ..|.|.|..:.   .:|.
Human     9 HLTFLGF-SITLLLVHGQGFQGTAA-IWPSLFNVNLSKKVQESIQI-PNNGSAPLLVDVRVFVSN 70

  Fly   242 HFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRI-------WKPHMNV 299
            .|....|.|..:|.||     :.:.|.|:||.|        .:..||...|       |.|.:.:
Human    71 VFNVDILRYTMSSMLL-----LRLSWLDTRLAW--------NTSAHPRHAITLPWESLWTPRLTI 122

  Fly   300 LNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQE 364
            |.........  ||.:..|..:|.:.|   ||.||:            ...|:.||         
Human   123 LEALWVDWRD--QSPQARVDQDGHVKL---NLALAT------------ETNCNFEL--------- 161

  Fly   365 NVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRN 429
               |.:        |.:|.|  ...||..:|...:|.:.|..         :..::.   :::|.
Human   162 ---LHF--------PRDHSN--CSLSFYALSNTAMELEFQAH---------VVNEIV---SVKRE 201

  Fly   430 RSFYMTVFYLP---LIACQMFLILSFVLRSTRRSSLILI-----ALLIA--AWGLMYMTRYASPH 484
            ...|.....:|   |:.|   ..::..|::|...|:|.:     |||:|  ..||:.:.......
Human   202 YVVYDLKTQVPPQQLVPC---FQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIG 263

  Fly   485 YVPPMMTAYKVI 496
            |...::.:|.|:
Human   264 YKVTLLLSYLVL 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/11 (45%)
Neur_chan_LBD 212..429 CDD:280998 45/227 (20%)
ZACNNP_851321.2 LIC 11..368 CDD:273305 71/336 (21%)
Neur_chan_LBD 54..>187 CDD:280998 41/185 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.