DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001356885.1 Gene:nAChRalpha5 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster

Alignment Length:342 Identity:74/343 (22%)
Similarity:130/343 (38%) Gaps:45/343 (13%)


  Fly   180 YLSFSS----FGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSIS 240
            ||:.|:    .|.:..|..:|. .|.|.:...|::                  |.|.|..|   |
  Fly   299 YLNLSAKVCLAGYHEKRLLHDL-LDPYNTLERPVL------------------NESDPLQL---S 341

  Fly   241 FHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGAL 304
            |......:. .::.:.||.|.:.:.:.|.|..|.|...|:|.::....|..|||||.:.:.|.|.
  Fly   342 FGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSAD 406

  Fly   305 QSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALI 369
            :......|: .::|..||| .||.......|.|......:|.:...|:::.|....:|.:....:
  Fly   407 EGFDGTYQT-NVVVRNNGS-CLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQL 469

  Fly   370 YDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYM 434
            .|:....|  :.:| ....|..  :.|....|:......|:..:     |:.....::|...:|.
  Fly   470 QDETGGDI--SSYV-LNGEWEL--LGVPGKRNEIYYNCCPEPYI-----DITFAIIIRRRTLYYF 524

  Fly   435 TVFYLPLIACQMFLILSFVL--RSTRRSSL---ILIALLIAAWGLMYMTRYASPHYVPPMMTAYK 494
            ....:|.:......:|.|.|  .|..:.||   ||::|.:.. .::..|..|:...||.:.|.:.
  Fly   525 FNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFL-NMVAETMPATSDAVPLLGTYFN 588

  Fly   495 VIMMTTTYCYILHICII 511
            .||.......:..|.|:
  Fly   589 CIMFMVASSVVSTILIL 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/15 (27%)
Neur_chan_LBD 212..429 CDD:280998 45/218 (21%)
nAChRalpha5NP_001356885.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.