DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_995675.1 Gene:nAChRalpha6 FlyBaseID:FBgn0032151 Length:523 Species:Drosophila melanogaster

Alignment Length:391 Identity:81/392 (21%)
Similarity:141/392 (36%) Gaps:86/392 (22%)


  Fly   209 IVKEETK---TEKLLSHLNIQAENASMP-ANLS---SISFHFQTRSLA-YEQTSSLLQTRMHMMM 265
            |:||..:   .::||:||.........| ||.|   .:.|....:.:. .::.:.:|.|...:.:
  Fly    20 IIKESCQGPHEKRLLNHLLSTYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNL 84

  Fly   266 HWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQN 330
            .|.|..|.|...::|.::.......::|||.:.:.|.|.:.......: .::|..||| .||...
  Fly    85 EWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHT-NIVVKHNGS-CLYVPP 147

  Fly   331 LQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF--TQ 393
            ....|.|......:|.:...|:::.|                               .|::  .|
  Fly   148 GIFKSTCKIDITWFPFDDQHCEMKFG-------------------------------SWTYDGNQ 181

  Fly   394 MSVVLVEND----SQRRYNPKGMMQKMTGD-------------VAIEFTLQ--RNRSFYMTVFYL 439
            :.:||...|    |....|.:..:..|.|.             |.|.||:|  |...:|.....:
  Fly   182 LDLVLNSEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIV 246

  Fly   440 PLIACQMFLILSFVLRSTRRSSLIL-IALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYC 503
            |.:......:|.|.|.......|.| :.:|::.  .:::...|..  :|....|..:|.:|    
  Fly   247 PCVLISSMALLGFTLPPDSGEKLTLGVTILLSL--TVFLNLVAES--MPTTSDAVPLIGVT---- 303

  Fly   504 YILHICIIWLDL----YPPRSKAPGWLVRVIN-------SNVLRCILGLRFSDSTDYCDIQE-NP 556
             ||....::|:|    .|..|.|...|....|       |:|:..::.|.:...|  .||.| .|
  Fly   304 -ILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRT--ADIHEMPP 365

  Fly   557 W 557
            |
  Fly   366 W 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 48/246 (20%)
nAChRalpha6NP_995675.1 LIC 11..517 CDD:273305 81/392 (21%)
Neur_chan_LBD 30..237 CDD:280998 47/240 (20%)
Neur_chan_memb 244..511 CDD:280999 30/135 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.