DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRbeta3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_525098.1 Gene:nAChRbeta3 FlyBaseID:FBgn0031261 Length:441 Species:Drosophila melanogaster

Alignment Length:448 Identity:90/449 (20%)
Similarity:161/449 (36%) Gaps:134/449 (30%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |..|.|::.|:.:                   ..|.|   :|.......:..::.:..|.|...:
  Fly    59 FTNYDSDVQPVFQ-------------------GTPTN---VSLEMVVTYIDIDELNGKLTTHCWL 101

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLN---GALQSMGQVLQSYE-------LMV 318
            .:.|||...||:|..:.::.........:|.|.:.:.|   |.|.:..||..|::       ..|
  Fly   102 NLRWRDEERVWQPSQYDNITQITLKSSEVWTPQITLFNGDEGGLMAETQVTLSHDGHFRWMPPAV 166

  Fly   319 YANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL---------NGQEGQENVALIYDDQR 374
            |              .::|..:..|||.::.:|.:::|.         ||....|  :|.:||. 
  Fly   167 Y--------------TAYCELNMLNWPHDKQSCKLKIGSWGLKVVLPENGTARGE--SLDHDDL- 214

  Fly   375 KPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYL 439
                    |.:|. |...         ||:..:    :.|...|.:....|.||..|.|..|.|.
  Fly   215 --------VQSPE-WEIV---------DSRAHF----VSQDYYGYMEYTLTAQRRSSMYTAVIYT 257

  Fly   440 PLIACQMFLILS-FVLRSTRRSSLI----LIALLIAAWGLMYMTRYASPHYVPPMM---TAYKVI 496
            | .:|.:.|.|| |.|........|    |:.::|||: |||..:      :.|::   |...||
  Fly   258 P-ASCIVILALSAFWLPPHMGGEKIMINGLLIIVIAAF-LMYFAQ------LLPVLSNNTPLVVI 314

  Fly   497 MMTTTYCY-----ILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFS------------ 544
            ..:|:..|     |:.:.:::|.....:.:.|..|.::::.::...:|...||            
  Fly   315 FYSTSLLYLSVSTIVEVLVLYLATGKHKRRLPEALRKLLHGHLGTWLLLSVFSTTGESQAEKTKE 379

  Fly   545 -DSTDY--CDIQEN------------------PWHHMAKILNNLSSILVIITFAIVDI 581
             |...|  .|.||:                  .|..:|..::.:|.:...:.|.|:.|
  Fly   380 MDEHPYEEADEQESSPLGINHTEVPGAKANQFDWALLATAVDRISFVSFSLAFLILAI 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/236 (18%)
nAChRbeta3NP_525098.1 LIC 39..437 CDD:273305 89/447 (20%)
Neur_chan_LBD 52..247 CDD:280998 47/249 (19%)
Neur_chan_memb 255..434 CDD:280999 38/187 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.