DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha7

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001162795.1 Gene:nAChRalpha7 FlyBaseID:FBgn0086778 Length:564 Species:Drosophila melanogaster

Alignment Length:357 Identity:78/358 (22%)
Similarity:132/358 (37%) Gaps:42/358 (12%)


  Fly   200 DGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMHM 263
            |.|.|...|:|                  |.|.|..|   ||......:. .::.:.||.|.:.:
  Fly    70 DNYNSLERPVV------------------NESDPLQL---SFGLTLMQIIDVDEKNQLLITNIWL 113

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            .:.|.|..|.|...:||.:.....|..|:|||.:.:.|.|.:.......: .::|..||| .||.
  Fly   114 KLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYAT-NVVVRNNGS-CLYV 176

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQ 393
            ......|.|......:|.:...|:::.|....:|.:....:.|:....|:   ...|...|..  
  Fly   177 PPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDEAGGDIS---SFITNGEWDL-- 236

  Fly   394 MSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL--RS 456
            :.|....|:......|:..:     |:.....::|...:|.....:|.:......:|.|.|  .|
  Fly   237 LGVPGKRNEIYYNCCPEPYI-----DITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDS 296

  Fly   457 TRRSSL---ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICII-WLDLYP 517
            ..:.||   ||::|.:.. .::..|..|:...||.:.|.:..||.......:..|.|: :....|
  Fly   297 GEKLSLGVTILLSLTVFL-NMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNP 360

  Fly   518 PRSKAPGWLVRVINSNVLRCILGLRFSDSTDY 549
            ...:...| :|||....|.|||.::......|
  Fly   361 DTHEMSEW-IRVIFLYWLPCILRMQRPGQVGY 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/218 (20%)
nAChRalpha7NP_001162795.1 LIC 59..548 CDD:273305 78/358 (22%)
Neur_chan_LBD 61..268 CDD:280998 48/231 (21%)
Neur_chan_memb 275..552 CDD:280999 29/120 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.