DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CG8916

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_573090.3 Gene:CG8916 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster

Alignment Length:391 Identity:84/392 (21%)
Similarity:147/392 (38%) Gaps:100/392 (26%)


  Fly   171 IDEAPLVINYLS---FSSF-----------GS-----NTARWFYDCGFDGYGSEIA--PIVKEET 214
            :.:.|.:.|..|   ||||           ||     |.....|.      .|||:  ..|:.:.
  Fly    41 LTKMPNITNEFSSRIFSSFRILPSSKPKTNGSLKRSQNATNLSYS------SSEISNQRRVRRKA 99

  Fly   215 KTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTR-------------MHMMMH 266
            ..:.|..::::..||.......|.:..|.|...... ||:.|:::.             .:...:
  Fly   100 AADMLSRNISMILENLLKRYEQSQLPTHGQGVPTVV-QTNILIRSMGPVSELDMDYSMDCYFRQY 163

  Fly   267 WRDSRLVWKPEDFGSLESFEHPDL------RIWKPHMNVLNGALQSMGQVLQSYELM-VYANGSI 324
            |||.||.:|    |.::|.   .|      :||:|.....||....:..:....:|: :..||.|
  Fly   164 WRDKRLSFK----GPIKSL---SLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGI 221

  Fly   325 TLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGW 389
             ||:..|.:.:.|....:|:|.:|.:|.:.:|..|...|:   |||:                 |
  Fly   222 -LYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQ---LIYE-----------------W 265

  Fly   390 SFTQMSVVLVENDSQRRYNPKGMMQ------KMTGDVA---IEFTLQRNRSFYMTVFYLPLIACQ 445
            .....:|..|...:..:::...||.      :..||.:   :.|.|:|:..:::...|:|   |.
  Fly   266 KNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVP---CI 327

  Fly   446 MFLILSFV-------LRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYK-VIMMTTTY 502
            :.::||:|       ..|.|.|..:...|.::...|...|......|.    ||.. .::|:..|
  Fly   328 LIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYA----TALDWFLLMSFLY 388

  Fly   503 C 503
            |
  Fly   389 C 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 10/39 (26%)
Neur_chan_LBD 212..429 CDD:280998 51/246 (21%)
CG8916NP_573090.3 LIC 92..598 CDD:273305 70/335 (21%)
Neur_chan_LBD 111..315 CDD:280998 50/233 (21%)
Neur_chan_memb 322..>403 CDD:280999 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.