DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and nAChRalpha3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001285015.1 Gene:nAChRalpha3 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster

Alignment Length:412 Identity:79/413 (19%)
Similarity:160/413 (39%) Gaps:63/413 (15%)


  Fly   176 LVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSIS 240
            ||::::| ||..:..|:..||.....|...:.|:|   ..|:.|...:.::.... :..||.:  
  Fly    12 LVLSFIS-SSTANPDAKRLYDDLLSNYNKLVRPVV---NVTDALTVRIKLKLSQL-IDVNLKN-- 69

  Fly   241 FHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQ 305
             ...|.:|..||:             |.|.:|.|:|:::|.:|....|...||:|.:.:.|.|..
  Fly    70 -QIMTTNLWVEQS-------------WYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADG 120

  Fly   306 SMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIY 370
            :....|.:...:.| .|.:......:..:| |......:|.:..||.::.|          :..|
  Fly   121 NFEVTLATKATLNY-TGRVEWRPPAIYKSS-CEIDVEYFPFDEQTCVMKFG----------SWTY 173

  Fly   371 DDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYN----PKGMMQKMTG-------DVAIEF 424
            |..:..:   .|::..:|.:..::.|.|.|..:...::    |....:|...       |:....
  Fly   174 DGFQVDL---RHIDELNGTNVVEVGVDLSEFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNI 235

  Fly   425 TLQRNRSFYMTVFYLPLIACQMFLILSFVLRS---TRRSSLILIALLIAAWGLMYMTRYASPHYV 486
            |::|...||.....:|.:......||.|.|.|   .:.|..|.|.|.:..:.|:..........|
  Fly   236 TMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLV 300

  Fly   487 PPMMTAYKVI-MMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYC 550
            .|::..:.:. |:..|:...:.:.::.:....|::......||.:..|.|...|.:|        
  Fly   301 VPLLGKFVLFTMILDTFSICVTVLVLNIHFRSPQTHTMAPWVRTVFINQLPRFLVMR-------- 357

  Fly   551 DIQENPWHHMAKILNNLSSILV 572
                .|.:.:::::.:...::|
  Fly   358 ----RPLYPISEMIKSSRRLMV 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/15 (33%)
Neur_chan_LBD 212..429 CDD:280998 42/228 (18%)
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 48/250 (19%)
Neur_chan_memb 248..>359 CDD:280999 22/123 (18%)
Neur_chan_memb <683..760 CDD:280999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.