DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb3b

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_775394.1 Gene:chrnb3b ZFINID:ZDB-GENE-030102-4 Length:462 Species:Danio rerio

Alignment Length:365 Identity:73/366 (20%)
Similarity:126/366 (34%) Gaps:95/366 (26%)


  Fly   184 SSFGSNTARWFYDCG----------FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSS 238
            |.|.:..||.|....          |.||...:.||:           |.|          :...
Zfish    14 SIFATTPAREFVSLAEREDALLRDLFQGYQRWVRPIL-----------HAN----------HTVK 57

  Fly   239 ISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL-- 300
            :.|..:...|. .::.:.|:.|.:.:...|.|.:|.|.||::|.:.....|...||.|.: ||  
Zfish    58 VRFGLKISQLVDVDEKNQLMTTNVWLYEEWLDYKLRWNPENYGGITFIRVPSESIWLPDI-VLYE 121

  Fly   301 NGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQEN 365
            |...:..|.::.  :.:|..||.|| :.......|.|......:|.:|..|.::.|         
Zfish   122 NADGRFEGSIMT--KAIVRYNGLIT-WTPPASYKSACTMDVTFFPFDRQNCSMKFG--------- 174

  Fly   366 VALIYDDQRKPIAPNEHVNTPSGWSF--TQMSVVLVENDSQRR---YNPKGMMQKMTGD------ 419
                                  .|::  ..:.:|||.:...|.   .|.:..:...||.      
Zfish   175 ----------------------SWTYDGNMVELVLVNHQVDRSDFFDNGEWEILSATGHKGSRRD 217

  Fly   420 -------VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRS-----TRRSSLILIALLIAAW 472
                   :...|.|:|...||.....:|.:......:|.|.|.|     ...|:.:|::|.:  :
Zfish   218 GHYSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTV--F 280

  Fly   473 GLMYMTRYASPHYVPPMMTAYKV-IMMTTTYCYILHICII 511
            .|:......|...|.|::..|.: ||:..|...|:.:.:|
Zfish   281 LLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVI 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 2/7 (29%)
Neur_chan_LBD 212..429 CDD:280998 43/238 (18%)
chrnb3bNP_775394.1 LIC 5..449 CDD:273305 73/366 (20%)
Neur_chan_LBD 31..235 CDD:280998 48/260 (18%)
Neur_chan_memb 242..446 CDD:280999 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.