DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CG6927

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_572194.1 Gene:CG6927 FlyBaseID:FBgn0029733 Length:524 Species:Drosophila melanogaster

Alignment Length:277 Identity:49/278 (18%)
Similarity:106/278 (38%) Gaps:67/278 (24%)


  Fly   246 RSLAYEQTSSLLQTRMHM-----------------------MMHWRDSRLVWK---PEDFGSLES 284
            |.:.|.:|...|...::|                       .|.:.|.||.::   |:....:..
  Fly    54 RPITYSETGQRLPVDVYMRAYIYFMQNLEAHDLQFKIYALLQMRYLDPRLNFRNVSPKRRQPILG 118

  Fly   285 FEHPDLRIWKPHMNVLNGALQS-MGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSER 348
            .||....:|.||:.:.|....| :|...:.....:..:|:: :.:..::...:|..:.:.:|.:.
  Fly   119 EEHLRNSLWMPHIFLANERDSSILGLTEKDILTSISPDGTV-IVSNRIKATLYCWLNLKKFPFDE 182

  Fly   349 VTCDIELGLNGQEGQENVA--LIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKG 411
            ..|...|    :....|.:  :::.:|::||       |..|      ::.|.|...||.::.:.
  Fly   183 QHCSTVL----ESWMYNTSELVLHWEQKRPI-------TYDG------ALHLTEFVLQRSWSNET 230

  Fly   412 MMQKMTGDV----------AIEFTLQRNR--SFYMTVFYLPLIACQMFLILSFVLRSTR------ 458
            ::.....|:          ::.||:...|  .||:..::||.:.......:||.|::.:      
  Fly   231 VINADLSDLRHGAFAGNYSSLSFTVHLTRVVGFYLMDYFLPSMLIVAISWVSFWLQADQAPPRIT 295

  Fly   459 --RSSLILIALLIAAWG 473
              .|:|:....|.:|.|
  Fly   296 LGTSTLLTFITLASAQG 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 36/222 (16%)
CG6927NP_572194.1 LIC 3..520 CDD:273305 49/278 (18%)
Neur_chan_LBD 36..259 CDD:280998 36/223 (16%)
Neur_chan_memb 270..518 CDD:280999 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.