DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrna1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_571520.1 Gene:chrna1 ZFINID:ZDB-GENE-980526-137 Length:456 Species:Danio rerio

Alignment Length:484 Identity:86/485 (18%)
Similarity:159/485 (33%) Gaps:182/485 (38%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |.||...:.|:           ||..   :...:...|..|..      ::.::.:.::.:.:.:
Zfish    32 FTGYNKVVRPV-----------SHFK---DPVVVTVGLQLIQL------ISVDEVNQIVTSNVRL 76

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            ...|:|..|.|.|:|:|.:.....|...:|||.:.:.|.|..... ::...::::...|.|| :.
Zfish    77 KQQWKDVHLQWNPDDYGGIRKIRIPSTDLWKPDLVLYNNADGDFA-IVHETKVLLEHTGMIT-WT 139

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPN------------- 380
            ......|:|.....::|.:...|.::||....:|  |:.:|..|..:|...|             
Zfish   140 PPAIFKSYCEIVVLHFPFDLQNCSMKLGTWTYDG--NLVIINPDSDRPDLSNFMESGEWVMKDYR 202

  Fly   381 --EH-------VNTP-------------------------SGWSFTQMSVVLVENDSQRRYNPKG 411
              :|       .:||                         ..:||....|..:..||.       
Zfish   203 SWKHWVYYACCPDTPYLDITYHFLLLRLPLYFIVNVIIPCMLFSFLTGLVFYLPTDSG------- 260

  Fly   412 MMQKMTGDVAIEFTLQRNRSFYMTVFYL-------------PLIACQMFLILSFVLRSTRRSSLI 463
              :|||..:::..:|        |||.|             |||...|...:.||:     :|:|
Zfish   261 --EKMTLSISVLLSL--------TVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVI-----ASII 310

  Fly   464 LIALLIAAWGLMYMTRYASP--HYVP-----------PMMTAY---------------------- 493
            :..::|       .|.:.||  |.:|           |.|..:                      
Zfish   311 ITVIVI-------NTHHRSPSTHIMPAWVRKIFIDTIPNMMFFSTMKRPSQERQEKRLFPADFDI 368

  Fly   494 -----KVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQ 553
                 |.:..:.||             :.|.:|         |.:|...|.|:::...|...|.:
Zfish   369 SDISGKPMPASVTY-------------HSPITK---------NPDVRSAIEGVKYIADTMKSDEE 411

  Fly   554 EN----PWHHMAKILNNLSSILVIITFAI 578
            .|    .|..:|.:|::   ||:.:..|:
Zfish   412 SNNAAEEWKFVAMVLDH---ILLCVFMAV 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/264 (17%)
chrna1NP_571520.1 LIC 21..447 CDD:273305 86/485 (18%)
Neur_chan_LBD 24..231 CDD:280998 39/223 (17%)
Neur_chan_memb 238..446 CDD:280999 47/255 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.