DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glra1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_005173152.1 Gene:glra1 ZFINID:ZDB-GENE-991117-1 Length:459 Species:Danio rerio

Alignment Length:310 Identity:64/311 (21%)
Similarity:122/311 (39%) Gaps:62/311 (20%)


  Fly   201 GYGSEIAPIVK----EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRM 261
            ||.:.|.|..|    :.:|::        .......|.|::...|.....|:|  :|:...:..:
Zfish    47 GYDARIRPNFKVVDPQGSKSD--------GTHKKGPPVNVTCNIFINSFGSIA--ETTMDYRVNI 101

  Fly   262 HMMMHWRDSRLVWK--PEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQSYELM-VYAN 321
            .:...|.|.||.:.  |:|...|:    |.:  .||||.:...|....:..:|....:|: :..|
Zfish   102 FLRQQWNDPRLAYSEYPDDSLDLD----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKN 162

  Fly   322 GSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYD-DQRKPIAPNEHVNT 385
            |:: ||:..:.|...|....:|:|.:..||.::|...|....:   ||:: |::..:...:.:..
Zfish   163 GNV-LYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMND---LIFEWDEKGAVQVADGLTL 223

  Fly   386 PSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLIL 450
            |.         .:::.:...||..|.........:...|.|:|...:|:...|:|          
Zfish   224 PQ---------FILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYYLIQMYIP---------- 269

  Fly   451 SFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
                      ||:::   |.:|...::...|:|..|...:|.  |:.|||
Zfish   270 ----------SLLIV---ILSWVSFWINMDAAPARVGLGITT--VLTMTT 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/223 (20%)
glra1XP_005173152.1 LIC 7..448 CDD:273305 64/311 (21%)
Neur_chan_LBD 38..259 CDD:280998 49/239 (21%)
Neur_chan_memb 266..445 CDD:280999 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.