DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrne

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_017452660.1 Gene:Chrne RGDID:2353 Length:547 Species:Rattus norvegicus

Alignment Length:380 Identity:82/381 (22%)
Similarity:149/381 (39%) Gaps:64/381 (17%)


  Fly   185 SFGSNTARWFYDCGFDGYGSEIAPIVK-EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSL 248
            |.|.|.....|...||.|..|..|:.: |:|.|..|...|          .||.|::        
  Rat    71 SQGKNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTL----------TNLISLN-------- 117

  Fly   249 AYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS 313
               :....|.|.:.:.:.|:|.||.:..:||..:|....|...:|.|.: ||...:.....|...
  Rat   118 ---EKEETLTTSVWIGIEWQDYRLNFSKDDFAGVEILRVPSEHVWLPEI-VLENNIDGQFGVAYD 178

  Fly   314 YELMVYANGSIT-----LYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIY--D 371
            ..::||..||::     :|      .|.|......:|.:...|.: :..:.....|.|..|:  |
  Rat   179 CNVLVYEGGSVSWLPPAIY------RSTCAVEVTYFPFDWQNCSL-IFRSQTYNAEEVEFIFAVD 236

  Fly   372 DQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTG---------DVAIEFTLQ 427
            |....|...: ::|.   :||:.....::      |.| ||::...|         ||.....::
  Rat   237 DDGNAINKID-IDTA---AFTENGEWAID------YCP-GMIRHYEGGSTEDPGETDVIYTLIIR 290

  Fly   428 RNRSFYMTVFYLPLIACQMFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPP 488
            |...||:....:|.:.....::|::.|  ::..:...:.|.:|:|....:::.....|.  ...|
  Rat   291 RKPLFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVP 355

  Fly   489 MMTAYKVIMMTTTYCYILHICIIWLD--LYPPRSKAPGWLVRVINSNVLRCILGL 541
            ::..|.:.:|......::: |:|.|:  |..|.:.|....:|.|...:|..:|||
  Rat   356 LLGRYLIFVMVVATLIVMN-CVIVLNVSLRTPTTHATSPRLRQILLELLPRLLGL 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 3/6 (50%)
Neur_chan_LBD 212..429 CDD:280998 49/233 (21%)
ChrneXP_017452660.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.