DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and HTR3E

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001243543.1 Gene:HTR3E / 285242 HGNCID:24005 Length:482 Species:Homo sapiens


Alignment Length:380 Identity:62/380 - (16%)
Similarity:112/380 - (29%) Gaps:144/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 NASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIW 293
            |.|:|..: :|||          ..|::|.      :.|.:..:.|.||:...:.........:|
Human    74 NISVPTQV-NISF----------AMSAILD------VVWDNPFISWNPEECEGITKMSMAAKNLW 121

  Fly   294 KPHMNVLN------------------------GALQSMGQVLQSYELMVYANGSITLYAQNLQLA 334
            .|.:.::.                        |.|..:.:..:.....|...|.|. |.:.:::.
Human   122 LPDIFIIELCVSRAGQREVPSPGSHRDHSLPLGPLMDVDKTPKGLTAYVSNEGRIR-YKKPMKVD 185

  Fly   335 SWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYD------DQRKPIAPNEHVNTPSGWSFTQ 393
            |.|......:|.::..|.:...          :.:|.      |..|.:           |..|.
Human   186 SICNLDIFYFPFDQQNCTLTFS----------SFLYTVDSMLLDMEKEV-----------WEITD 229

  Fly   394 MSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFY-MTVFYLPLIACQMFLILSFVLRST 457
            .|..:::...:         .::.|.......|.|..:.| ..|||:.:               .
Human   230 ASRNILQTHGE---------WELLGLSKATAKLSRGGNLYDQIVFYVAI---------------R 270

  Fly   458 RRSSLILIAL------LIAAWGLMYMTRYASPHYVP---PMMTAYKVIMM--------------- 498
            ||.||.:|.|      |:|...|.:.....|.:.||   .::..|.|.::               
Human   271 RRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIG 335

  Fly   499 ----------------TTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRC 537
                            |....::||:.    ...||  ..|.||    :|.:|.|
Human   336 VYFALCLSLMVGSLLETIFITHLLHVA----TTQPP--PLPRWL----HSLLLHC 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 32/229 (14%)
HTR3ENP_001243543.1 Neur_chan_LBD 70..273 CDD:280998 38/261 (15%)
Neur_chan_memb 280..>379 CDD:280999 18/108 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.