DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-43

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001023062.1 Gene:lgc-43 WormBaseID:WBGene00008076 Length:679 Species:Caenorhabditis elegans

Alignment Length:747 Identity:127/748 (17%)
Similarity:234/748 (31%) Gaps:257/748 (34%)


  Fly     4 LIKGSLATYC-CLCLLLILIDPAE----------SGQLSTRFN-VSFAQLDSCETYSV------- 49
            :|:.||:..| .|.|.:|.||..|          |...|:.|: :.|....|.:|..:       
 Worm     2 MIRCSLSIICILLSLSVIRIDANEVLTTEASTDSSSPTSSIFDWIPFKLFGSEKTTPILRIKVRA 66

  Fly    50 PNTGYGYRRFYMLRELSNNN--RKAGERLHLKFYVLTAMDAHILLSVTNHPRPNDRVYE------ 106
            .|.....::..:|:|:.|.:  :|..|:   :|..:..:...:.....|.|   |::||      
 Worm    67 VNRVIYTKKDNLLQEIENASEYKKEQEK---QFEQIPDVSTEVKEVSINEP---DKMYERGEEPK 125

  Fly   107 -IVIGAGGNTFSAIR---------NAMGMRRVATNQEPNLVSLYDPTPIEIV-------QNQNGE 154
             .:....|||...|.         ..:...:|.|.::.:...:||....|.|       .::||.
 Worm   126 IFLFPKQGNTVPKIEGEFEKVDIIGEVSEDKVKTPKDDDFQIMYDDELKEYVLKRRPLKMDKNGI 190

  Fly   155 LFVYIPGFKKEPLLQFIDEAPLVI--------------------NY--------------LSFSS 185
            :..:..|..||.:....||...::                    |:              |.|.|
 Worm   191 IDSWNGGDTKEIMDDSDDEVKRILESGEEGLVGKNNRTLKTQQRNHTEVTLEEEEINLEDLQFKS 255

  Fly   186 F----GSNTARWFYDCGF-----------------------------------------DGYGSE 205
            :    |.:..| .||..:                                         ..|||.
 Worm   256 YQFKPGKSKIR-TYDLAWMDPSFLEKEEFSVRLTSQQRSDWRDKLTNLTMLEERRANEHRDYGSS 319

  Fly   206 -IAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFH----FQTRSLAYEQTSSLLQTRMHMMM 265
             |.|::|            ::..:|.|:|...:.|..:    |....|| ...|.:::..|.:.|
 Worm   320 YILPVLK------------SVDYDNTSVPLAFNDIPVNVAVAFNFLYLA-NFDSEMMEFSMDVEM 371

  Fly   266 H--WRDSRLV---WKPEDFGSLESFEHPDL-RIWKPHMNVLNGALQSMGQV-LQSYELMVYANGS 323
            .  |.|.|||   .||     :...|.|.: :||:|...::|........| ..:..:.:...|.
 Worm   372 EFSWIDIRLVNNYTKP-----IRIREKPIIEQIWRPDPYIVNSKHSYFHYVSFPNIRMRITPEGL 431

  Fly   324 ITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQ-------RKPIAPNE 381
            :| |...:.....|..|...:|.:|..||:.:.          ::.|.:|       ..||....
 Worm   432 VT-YTVRVSSVCSCFMSFCLYPHDRQECDLRIS----------SIAYSNQYVKFHWHSNPIKFQS 485

  Fly   382 HVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQM 446
            .:..|      ::.:..::.   ...:.||.:.. ...:.|.|:|:|:.:.::...|:|.....|
 Worm   486 KITLP------ELHITKIKT---AECSTKGKLVD-ASCLRIIFSLERDSARFVIEKYVPSTLAMM 540

  Fly   447 FLILSFVLRSTRRSSLILIALLIAAWGLMYMT-RYASPHYVPPMMTAYKVIMM-------TTTYC 503
            |                       ||...|:. .|.....:.|:.....::.|       .|:|.
 Worm   541 F-----------------------AWVAPYVPYNYEDVRIITPITVLLTLVQMEKGDKEIRTSYL 582

  Fly   504 YILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGL-----------------RFSDSTDYCD 551
            ..:.:                |...:.:..||..:..|                 |.::..:.|.
 Worm   583 TSIDV----------------WFAAMKSFTVLSLLESLAVLALIKRSRAMTKNAERAANEFERCT 631

  Fly   552 IQE-----NPWHHMAKILNNLSSILVIITFAI 578
            .:.     |..:|....:...||.:|.:.|.:
 Worm   632 FEAEAYRLNRLYHRVDSICRFSSPVVFVAFFV 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 27/162 (17%)
Neur_chan_LBD 212..429 CDD:280998 44/235 (19%)
lgc-43NP_001023062.1 Neur_chan_LBD 329..491 CDD:280998 38/185 (21%)
Neur_chan_memb 532..>613 CDD:280999 16/120 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.