DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrng

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_062018.1 Gene:Chrng RGDID:2354 Length:519 Species:Rattus norvegicus

Alignment Length:362 Identity:72/363 (20%)
Similarity:135/363 (37%) Gaps:65/363 (18%)


  Fly   211 KEETKTEKLLSHLNIQAENASMPANLSS----ISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDS 270
            :...:.|:||:.|....:....||...|    :|.... |..::..:....|.|.:.:.|.|.|.
  Rat    21 QSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY 85

  Fly   271 RLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLAS 335
            ||.|.|:|:..|.....|...:|:|.: ||...:..:.:|.....::|..:|.| .:.......|
  Rat    86 RLRWDPKDYEGLWILRVPSTMVWQPDI-VLGNNVDGVFEVALYCNVLVSPDGCI-YWLPPAIFRS 148

  Fly   336 WCVDSARNWPSERVTC------------DIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSG 388
            .|..|...:|.:...|            :|.|.|:.::||. :..|:.|   |.|..|:    ..
  Rat   149 SCSISVTYFPFDWQNCSLVFQSQTYSTSEINLQLSQEDGQA-IEWIFID---PEAFTEN----GE 205

  Fly   389 WSFTQMSVVLVENDSQRRYNPKGMM------------QKMTGDVAIEFTLQRNRSFYMTVFYLPL 441
            |:.              |:.|..|:            ||    |.....:||...||:....:|.
  Rat   206 WAI--------------RHRPAKMLLDPVTPAEEAGHQK----VVFYLLIQRKPLFYVINIIVPC 252

  Fly   442 IACQMFLILSFVLRSTRRSSLILIA--LLIAAWGLMYMTRYASPH--YVPPMMTAYKVIMMTTTY 502
            :......||.:.|.:........:|  :|:|....:::.....|.  ...|:::.|...:|..|.
  Rat   253 VLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLMVVTI 317

  Fly   503 CYILH-ICIIWLDLYPPRSKAPGWLVRVINSNVLRCI 538
            ..::: :.::.:.|..|.:.:   :.|.:....||.:
  Rat   318 LIVVNSVVVLNVSLRSPHTHS---MARGVRKVFLRLL 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/246 (22%)
ChrngNP_062018.1 LIC 23..497 CDD:273305 72/361 (20%)
Neur_chan_LBD 26..241 CDD:280998 53/243 (22%)
Neur_chan_memb 248..494 CDD:280999 17/108 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.