DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_077330.1 Gene:Chrna4 RGDID:2346 Length:630 Species:Rattus norvegicus

Alignment Length:365 Identity:77/366 (21%)
Similarity:145/366 (40%) Gaps:32/366 (9%)


  Fly   213 ETKT---EKLLSHLNIQAENASMP-ANLSSISFHFQTRSLA----YEQTSSLLQTRMHMMMHWRD 269
            ||:.   |:||..|.......|.| .|:|.:.......|:|    .::.:.::.|.:.:...|.|
  Rat    33 ETRAHAEERLLKRLFSGYNKWSRPVGNISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHD 97

  Fly   270 SRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLA 334
            .:|.|.|.|:.::.|...|...||:|.:.:.|.|..... |....:..::.:|.:......:..:
  Rat    98 YKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFA-VTHLTKAHLFYDGRVQWTPPAIYKS 161

  Fly   335 SWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR-KPIAPNEHVNTPSGWSFTQMSVVL 398
            |..:| ...:|.::..|.::.|          :..||..: ..::.:..|:....|...:..:| 
  Rat   162 SCSID-VTFFPFDQQNCTMKFG----------SWTYDKAKIDLVSIHSRVDQLDFWESGEWVIV- 214

  Fly   399 VENDSQRRYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLP--LIACQMFLILSFVLRSTRR 459
               |:...||.:  ....::..|:...|.::|...||.....:|  ||:|...|:.........:
  Rat   215 ---DAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEK 276

  Fly   460 SSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVI-MMTTTYCYILHICIIWLDLYPPRSKA 522
            .:|.:..||.....|:.:|. ..|...|.|::..|.:. |:..|...::.:.::.:....||:..
  Rat   277 VTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHT 341

  Fly   523 -PGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMA 561
             |.|:.||....|.|.:...|.|...|.|.......|.||
  Rat   342 MPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMA 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/227 (19%)
Chrna4NP_077330.1 Neur_chan_LBD 39..245 CDD:280998 42/222 (19%)
Neur_chan_memb 252..621 CDD:280999 31/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.